ELF4h4 (444  TTTzz   dԂ   hhh QtdRtd   e(/lib/ld-linux.so.2GNU FZrfhjklmnop!Na%d67"'wxyu{~ t[\^|}DEFGJKLMB*+-./12345q] &c):;<=>?@AC gs0` O(,b8_P#RSTUVWXYQ$i ez IH9v* D?D0I4@P`   *+,./123456789:;<=>?@ACDEFGHIJKLMNOPQRSTUVWXYZ[\^_`acefhiklmnopqrstuvwxyz{}u1Nu1N w1Nw1Nx1N!y1N{1N{1N}1N}1NkYkYgf= "= "? "? "A "A "C "C "D "ݣkE "1Nۗ1Nۗ1Nۙ1Nۙ1Nۛ1Nۛ1N۝1N۝1N۟1No3b 1hs1hs1hs1hs1hs1hs1hs1hs1hs1hsI1N۶1Nۍe1Nk C9`dʼnĹ@k|/1hs.1hs|11hs 11hs31hs31hs51hs51hs71hs71hs#l`g1U/eV/eN1hsQ1hsQ1hsS1hsS1hsU1hsU1hsW1hsW1hsY1hsCEYG-/ś : q1hsq1hss1hsoqXS1NU1NU1NW1NW1NY1NY1N[1N[1N]1NۭKGK}o  uz1lL*h0N>W!dV=DsE`1u*1u@ 1u 1u`1up` .1ut1u 1u`_1uF1u1u@KA bt3!^I1uD 1uU`41u1u}1u, 1u=` 1u~1u1u i1uQ|  y9]u  O`1uS1uI1! `  )$(,0A4)p ^p( PZ '`1ug1uyv1u 1u`a1u81uK1u 1u`6 1uY8 1u?<P@DxH'L8PTX\Wpq!  0   J`d}hPD  hp~ 1u> 1u` 1u 1u 1ub k 1u` 1uU 1u 1uz @1u.p3  __gmon_start___Jv_RegisterClasseslibc.so.6_IO_stdin_usedstrncmp__strdupclosedir__stack_chk_failunlinkmkdirreallocgetpidchmodstrtokstrlenmemsetstrstr__errno_locationrmdiropen64read__fprintf_chkmemcpymalloc__strncpy_chkopendir__xstat64__ctype_b_locstderrgetuidreadlinkexecvp__memcpy_chkcloselseek64readdir64__sprintf_chkmemmoveaccessstrcmp__libc_start_mainwritefree__environpar_current_execsize_load_my_libperl_16par_basenamesize_load_my_par_1__libc_csu_finisize_load_my_libperl_21size_load_my_libperl_8size_load_my_libperl_25size_load_my_libperl_29size_load_my_libperl_30_fp_hwsize_load_my_libperl_34size_load_my_libperl_4size_load_my_libperl_41size_load_my_libperl_38size_load_my_libperl_0par_env_cleanpar_current_exec_procpar_dirnameget_username_from_getpwuidsize_load_my_libperl_11par_cleanupsize_load_my_libperl_15size_load_my_libperl_19size_load_my_libperl_20size_load_my_libperl_9size_load_my_libperl_24size_load_my_libperl_28__data_startsize_load_my_libperl_33size_load_my_libperl_37my_mkfilesize_load_my_libperl_5size_load_my_libperl_40size_load_my_libperl_1size_load_my_libperl_10size_load_my_libperl_14size_load_my_libperl_18name_load_my_par__libc_csu_initsize_load_my_libperl_27size_load_my_libperl_23name_load_my_libperlsize_load_my_parsize_load_my_libperl_36size_load_my_libperl_32__bss_startsize_load_my_libperl_2size_load_my_libperl_6size_load_my_libperl_17size_load_my_libperl_13size_load_my_par_0_endsize_load_my_libperl_26size_load_my_libperl_22par_mktmpdirsize_load_my_libperl_35size_load_my_libperl_31_edatapar_setup_libpathpar_findprogsize_load_my_libperl_42size_load_my_libperl_3size_load_my_libperlsize_load_my_libperl_7size_load_my_libperl_39par_init_envsize_load_my_libperl_12GLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.1GLIBC_2.3.4GLIBC_2.0$ii ii ii )ii 3ti =ii I`c   $ ( , 048<@DHLPTX\`dhlptx |!"#$%&'()UH/5%%h%h%h% h%h %h(%h0%h8p% h@`%$hHP%(hP@%,hX0%0h` %4hh%8hp%<hx%@h%Dh%Hh%Lh%Ph%Th%Xh%\hp%`h`%dhP%hh@%lh0%ph %th%xh%|h%h%h%h%h%h %h(%h0%h8p1^PTRh@hPQVhUS[4itX[ÐUS=u?9s9r[]Ít&'Utt $ÐUVuSt,Vf8 Dƒu[^]Í'U1҉WVSP ȉ ؉ ؁ ȉu΍M萍t&B33B3BB 9u苅щArzR yZ!! ؋!! ؋yZyZω!! !! 7yZ;yZÉӉ!! !lj! yZ:yZ!! !! yZljyZ։!! !! 󋵤yZ1yZ!! !! 򋵤yZ։yZω!! !! yZljyZӉ!! !! ً yZˉyZƉ!! !! 򋵤yZ։yZω!! !ω! yZ11;n11Ǎ9n 11ߍ>n4711ύ:n118n11n11nˉ 11n$ 11ލ2n։(11n,118n011n411nˉ811n< 11ލ2n։@11nD118nH11nL11n P11TnƉ !! ֋X2ܼΉ Ɖ!! \7ܼ߉ ω؉!! Nj`8ܼ׉ ߉!! ϋd9ܼ  ׉!! ߋh;ܼlj !! ׋l:ܼω lj!! >ܼp47 ω!! Njt8ܼ׉ ߉!! ϋx9ܼ  ׉!! ߋ|;ܼlj !! ׋u:ܼω lj!! >ܼE47߉ ω!! NjM8ܼ׉ ߉!! ϋ]9ܼ  ׉!! ߋU;ܼlj !! ׋u:ܼω lj!! E>ܼ47߉ ω!! NjM8ܼ׉ ߉!! ϋ]9ܼω񉝤 щ!! ًU ܼÉ11bӉu11bʉE11ލ0bʉƉ}11bʉM119bʉ]11 bʉU 11bʉӉu11bʉEč11ލ0bʉƉ}11bʉM̍119bʉ]Љ11 bʉUԍ 11bʉӉu11bʉE܍11ލ0bʉƉ}11bʉM119bʉ] 11Ǎ;bʉU11ύ:bʉ׋Ubʉ11ڍ򋵬~^N FP[^_]Í'U8]Éu}Uu1]u}]ÐEt<=t]tW<=tu)ڋE0t]ljӍ&E\$4$D$Eu<=t7uf농1뵍t&+}E8DfUltÍUtt<0lÐ1UVS]E҉Puډuۃ[^]Ít&UWVS1<Ӏ:=É$qUljt1$EV1ɋU9u  u<1[^_]á1ҹ8t& u =t.L$$UU<[^_]É $U+UЅtՍEԉD$ $D$MPM̉ UDU=҉u ft=vu)UԍD8$UUЅJU䡠҈t$=t =t&t҈u=1f LuEEME31dUWV0eE1ủEҡE֡EڡEޡEEEEfEuk#a,W3MCCO9/X%blyt ¸X!t ¸t5¸O3Ee3uN0^_]Í&dt¸fu uUt&'UWVSu ]}4$<$EUD$9|$t$D$ D$D$$oED$$D$trD$D$A$Ht Ĝ[^_]D$D$ED$4D$D$ $Ĝ1[^_]ÍU9Uu랐UWVSluEEEEEE*E$UD$t:;t-߃ÍUt8uNjU;uӃl[^_]ËM $]Eġ0$MU$E?MEEčLEȉ$UD$ :D$D$T$0 $MD$ED$MM6&UWVSt8uĜ[^_]Í$Ptf4$`X @9 9<$[$EPUD$E\$|$D$ D$D$$ED$E$D$tE%=@E$E$^4$64$<$8Ĝ[^_]Ðt&S: vC:  C: vErt&'USÃtED$\$$@uE%=t=@tt1[]Í$D$t[]Ív'U$1tÐUVS]ta;t\$D95,8t Z8uP9r9؍vuV:u[^]Ut&$tf.[^]Ít&8t9r9؍vt9s:t1)ڍJwD$ T$\$$똍v$$1tf.u5,0t&UWVSu4$ljÄt ,W8 Dڃu,tt>tD$ $9t[^_]Ã[^_]Dt&UWVS쬀EeU1ҍu tO,\$Njt$"t1tlUe3tĬ[^_]Ët$4$p0D$tppv> Dtt$<$54$%T:uJB: tp=7t$\$t$D$D$ :D$D$D$T$$u%=tA0$D$ƅv0$T$֍D$$ul$tU~&'UWVSLE@eU1҉Dž$~ODž(Dž, Dž0Dž DžDžDžDž&Dž Dž4*Dž8/Dž<[t 8St(t&Yu_u荝v8tpt܉<$ftΉlj<$Ë$$~~$É~ ,|$D$ T$L$D$ 8D$D$$D$<$$~D$$$~~~/[g2Sc'+RUQa F ,R@@Ѕ%@))`O(i8G @ACDEFGIJKLMNOPQRSTUVWYZ[]_abcdeghijklm  CE}AŹG/śFl`I qX|!gfʼnWwF oY Wo : d|KM]DԊG[w˦ݣk~ITŹ@?," k|l_{k C3b{JkG-"xci i^DPR0\B"PKH:q1a(W9,9' lLAzAm( Ch `3 P  YA@( dAAQ  0 qA!IZ  Ar@A(P| APD  6@  4hA`AArA!A  p ^$ApAA$  Akж HA^[4@: t0  Alibperl.so.5.12__gmon_start___Jv_RegisterClassesPL_curstackinfoPerl_dounwindperl_constructPerl_newXSPL_opPL_exit_flagsperl_freeperl_runPerl_safesysmallocPerl_newXS_flagsPerl_av_fetchPerl_mg_setPerl_newSVpvPerl_sys_termPL_eval_rootPL_parserPL_taintedPerl_croakPerl_sv_setpvPerl_sv_2pv_flagsPerl_save_destructor_xperl_destructPL_in_evalperl_parseboot_DynaLoaderPL_compcvPerl_sv_setpvnPerl_gv_fetchpvPL_perl_destruct_levelPerl_sys_init3PL_do_undumpPerl_av_shiftperl_allocPL_top_envPL_memory_wraplibc.so.6_IO_stdin_usedexitstrncmp__strdupclosedir__stack_chk_failunlinkmkdirreallocmemchrgetpidstrtokstrlenmemsetstrstr__errno_locationrmdiropen64readmemcpy__strncpy_chk__lxstat64opendir__xstat64__ctype_b_locgetuidreadlinkexecvp__memcpy_chkcloselseek64readdir64__sprintf_chkmemmoveaccessstrcmp__libc_start_main__environ_edata__bss_start_endpar_current_execpar_basename__libc_csu_fini_fp_hwXS_Internals_PAR_BOOTpar_env_cleanpar_current_exec_procpar_dirnameget_username_from_getpwuidpar_cleanup__data_startxs_init__libc_csu_initname_load_my_par_plXS_Internals_PAR_CLEARSTACKsize_load_my_par_plpar_mktmpdirpar_setup_libpathpar_findprogpar_init_envGLIBC_2.4GLIBC_2.3GLIBC_2.2GLIBC_2.1GLIBC_2.3.4GLIBC_2.0ii ii ii ii ti ii  ? AP$Aa@AQHAgLAA`A[dAIhAZAbA\ATA^Am@@@ @@@@@ @ $@ (@ ,@ 0@4@8@<@@@D@H@L@P@T@X@\@`@d@h@kl@p@t@x@|@ @!@"@#@$@%@&@'@(@)@*@+@,@-@.@/@0@1@2@3@4@5@6@7@8@9@:@;@<@=@>@?U1/5?%?%@h%@h%@h% @h%@h %@h(%@h0%@h8p% @h@`%$@hHP%(@hP@%,@hX0%0@h` %4@hh%8@hp%<@hx%@@h%D@h%H@h%L@h%P@h%T@h%X@h%\@hp%`@h`%d@hP%h@h@%l@h0%p@h %t@h%x@h%|@h%@h%@h%@h%@h%@h %@h(%@h0%@h8p%@h@`%@hHP%@hP@%@hX0%@h` %@hh%@hp%@hx%@h%@h%@h%@h%@h%@h%@h%@hp%@h`%@hP%@h@%@h0%@h %@h%@h1^PTRhhQVhжUS[Dt:X[ÐUS=Au?A? ?9sA ?A9rA[]Ít&'U?tt $?ÐUVuStVf8 Dƒu[^]Í'U1҉WVSP ȉ ؉ ؁ ȉu΍M萍t&B33B3BB 9u苅щArzR yZ!! ؋!! ؋yZyZω!! !! 7yZ;yZÉӉ!! !lj! yZ:yZ!! !! yZljyZ։!! !! 󋵤yZ1yZ!! !! 򋵤yZ։yZω!! !! yZljyZӉ!! !! ً yZˉyZƉ!! !! 򋵤yZ։yZω!! !ω! yZ11;n11Ǎ9n 11ߍ>n4711ύ:n118n11n11nˉ 11n$ 11ލ2n։(11n,118n011n411nˉ811n< 11ލ2n։@11nD118nH11nL11n P11TnƉ !! ֋X2ܼΉ Ɖ!! \7ܼ߉ ω؉!! Nj`8ܼ׉ ߉!! ϋd9ܼ  ׉!! ߋh;ܼlj !! ׋l:ܼω lj!! >ܼp47 ω!! Njt8ܼ׉ ߉!! ϋx9ܼ  ׉!! ߋ|;ܼlj !! ׋u:ܼω lj!! >ܼE47߉ ω!! NjM8ܼ׉ ߉!! ϋ]9ܼ  ׉!! ߋU;ܼlj !! ׋u:ܼω lj!! E>ܼ47߉ ω!! NjM8ܼ׉ ߉!! ϋ]9ܼω񉝤 щ!! ًU ܼÉ11bӉu11bʉE11ލ0bʉƉ}11bʉM119bʉ]11 bʉU 11bʉӉu11bʉEč11ލ0bʉƉ}11bʉM̍119bʉ]Љ11 bʉUԍ 11bʉӉu11bʉE܍11ލ0bʉƉ}11bʉM119bʉ] 11Ǎ;bʉU11ύ:bʉ׋Ubʉ11ڍ򋵬~^N FP[^_]Í'U8]Éu}Uu1]u}]ÐAEt<=t]tW<=tu)ڋE0t]ljӍ&E\$4$D$u<=t7uf농1뵍t&+}E8DfUU2UAtÍtt<0AÍt&1UVS]EA҉Puډuۃ[^]Ít&UH}]ÉueE1D$|$$]~W@tBt$D$/<$t2t$|$$bEe3u*]u}]Ðt붋$D$&U$D$$ЬÐ&UShA$AHLA@ fAhAXD$$lChA`A@P hAAH1tBlA$hA@@(hA@@hAA@P,[]ÍUWVSt8uĜ[^_]Í$Ptf4$X@99<$$EUD$!E\$|$D$ D$D$$ED$E$D$tE%=@E$)E$>4$64$P<$Ĝ[^_]Ðt&S:vC: C:vErt&'USÃtED$\$$uE%=t=@tt1[]Í$D$t[]Ív'UH ]eE1u}D$D$ D$D$$D$y 1ۋUe3uW]u}]ÍvD$|$$nx@$ tt$|$$73 U$t&UWVS1<Ӏ:=É$Uljt1$E1ɋU9u  u<1[^_]áA1ҹ8t& u =At.L$$UAU<[^_]É $AUUЅtՍEԉD$A $D$M0M̉ AUDU=҉u ft=vu)UԍD8A$UtUЅJU䡀A҈t$=t =t&t҈u=1f LuEEME31dUWVSluEEEEEEl*E$UD$t:;t*߃Ét8uʋU;uփl[^_]ÍvM $Eġ$U$EMEEčLEȉ$UD$ D$D$T$ $MD$ED$iM6&UWV0eE1EҡE֡EڡEޡEEEEfE!*1AMVx`njdwZPt ¸Vt ¸t.¸M1Ee3uG0^_]øvt¸t&u uUbKt&'U$1tÐUVS]ta;t\$DD958t Z8uP9r9؍vuV:u[^]t&$tf.[^]Ít&8t9r9؍vt9s:t1)ڍJwD$ T$\$$AA똍v$1tf.u50t&UWVSu4$ljÄt W8 Dڃutt>tD$$n9t[^_]Ã[^_]t&UVS8ED$E D$E$=AE1ɉL$, @AD$(l$(`h0$au Q@@@ ]Q~ L 9D$ Q\$D$D$$+teQ$HAntbQ$(8[^]Ðt&Qtr$B AQ$늍&Qt $닸MQtD$A$x$UWVSEeU1ҋu tM\$Njt$Ht1tjtUe3tĬ[^_]Ët$u4$pD$>tpp>Dtt$<$4$T:uJB: tp=9t$\$t$D$D$ D$D$D$T$$%u%=tA$D$Jƅv$T$"֍D$$uj$tWUWVSLEeU1Dž(Dž,MDž0Dž4lDžDžDžDžDž Dž$lDž8 Dž<Dž@lt 8vt"vYu_u荝v8tJtމ4$nt҉Ɖ4$<$$~1~$É~ |$D$t$L$D$ D$D$$kD$<$E$D$$$~~~~>t"u,~~ D::Eu$D$$1WD$lD$ @D$T$D$D$$D$8V8ua D$ lt$|$L$D$ ND$D$D$$D$$t<$ڸMK$#Ue3~]L[^_]f, v;t1҅t$tۉ\t&i<$~~Lt'<1$~b~$T~&< t&3t$'8uݿ_cv^vD$ D$D$$DD$T$ $Du ECkD$ D$D$$\`DžD#EgDžHDžLܺDžPvT2DžTDžXDž\E~~t&DD$D$$X~XD\9ʃ\\EXtV@)9`ND|$T$$E@EbD)D<9t&?1t&7`D7dD7hD7 lD7pD7tD7xD7|D7 ED7$ED7(ED7,ED70ED74ED78ED7<@ED)?^@|:@)Ӊ|$`D$ D\$<$]]t&~ $X\?Ƅ`88`)~L$D$$*~EEEEEE1EDU}DȈMЉMщшUӋHM҉MԉMՉшU׋LM։M؉MىшUۋPMډM܉M݉шUߋTMމMMMUvD5<$D$D$ ;D$D$^uEUD$l T$D$ ,L$|$D$D$$H`@)L$~D$$D~1󫋕~:fFAGC{HHnIEaD$ D$D$<$DD$)D$<$#DD$lt&'U1WVSdAt 81D$ D$$fg@ 1xQ3s@ QD$$uLQ9~BD$t$<$t%@ uD$D$$랍vQP9D$D$$kt$D$m@ $C @ @D$D$$ft#jFD$C $]MdAHAQD$$et t [^_]Ívf<$9Q$1vx#vC QDQ$5QQC @ t|@ t$$ƋC @ tF@ D$Qt$ $D$D$ QD$Q$D$D$D$$D$D$$jt&UD$rD$0$|NÍU(D$D$ lD$lD$$IÐU]Ít&'UWVSOw?)t$1ED$E D$E$9rރ[^_]Ë$ÐUS?t?fЋu[]ÐUS[LwY[PAR_CLEAN/proc/self/exe..%s/%s/proc/%i/%sLIBPATHDYLD_LIBRARY_PATHPERL5LIBPERLLIBPERL5OPTPERLIOPAR_INITIALIZEDPAR_SPAWNEDPAR_TEMPPAR_DEBUGPAR_CACHEPAR_PROGNAMEPAR_ARGCPAR_ARGV_0PAR_GLOBAL_DEBUGPAR_GLOBAL_TMPDIRPAR_TMPDIRPAR_GLOBAL_TEMPPAR_GLOBAL_CLEANPAR_CLEAN=1par--e--C:\TEMP/tmpTEMPDIRTMPUSERUSERNAME%s%s%s%sparl.par%s%scache-%s%s%02x%s%stemp-%u%s%s%stemp-%u-%u%sSYSTEMARGVperlperlxsi.cDynaLoader::boot_DynaLoaderInternals::PAR::BOOT/:__ENV_PAR_CLEAN__ %s: execution of %s failed - aborting with %i. %s: creation of private temporary subdirectory %s failed - aborting with %i. Apar.pl#!/usr/bin/perl eval 'exec /usr/bin/perl -S $0 ${1+"$@"}' if 0; # not running under some shell package __par_pl; # --- This script must not use any modules at compile time --- # use strict; #line 158 my ($par_temp, $progname, @tmpfile); END { if ($ENV{PAR_CLEAN}) { require File::Temp; require File::Basename; require File::Spec; my $topdir = File::Basename::dirname($par_temp); outs(qq{Removing files in "$par_temp"}); File::Find::finddepth(sub { ( -d ) ? rmdir : unlink }, $par_temp); rmdir $par_temp; # Don't remove topdir because this causes a race with other apps # that are trying to start. if (-d $par_temp && $^O ne 'MSWin32') { # Something went wrong unlinking the temporary directory. This # typically happens on platforms that disallow unlinking shared # libraries and executables that are in use. Unlink with a background # shell command so the files are no longer in use by this process. # Don't do anything on Windows because our parent process will # take care of cleaning things up. my $tmp = new File::Temp( TEMPLATE => 'tmpXXXXX', DIR => File::Basename::dirname($topdir), SUFFIX => '.cmd', UNLINK => 0, ); print $tmp "#!/bin/sh x=1; while [ \$x -lt 10 ]; do rm -rf '$par_temp' if [ \! -d '$par_temp' ]; then break fi sleep 1 x=`expr \$x + 1` done rm '" . $tmp->filename . "' "; chmod 0700,$tmp->filename; my $cmd = $tmp->filename . ' >/dev/null 2>&1 &'; close $tmp; system($cmd); outs(qq(Spawned background process to perform cleanup: ) . $tmp->filename); } } } BEGIN { Internals::PAR::BOOT() if defined &Internals::PAR::BOOT; eval { _par_init_env(); if (exists $ENV{PAR_ARGV_0} and $ENV{PAR_ARGV_0} ) { @ARGV = map $ENV{"PAR_ARGV_$_"}, (1 .. $ENV{PAR_ARGC} - 1); $0 = $ENV{PAR_ARGV_0}; } else { for (keys %ENV) { delete $ENV{$_} if /^PAR_ARGV_/; } } my $quiet = !$ENV{PAR_DEBUG}; # fix $progname if invoked from PATH my %Config = ( path_sep => ($^O =~ /^MSWin/ ? ';' : ':'), _exe => ($^O =~ /^(?:MSWin|OS2|cygwin)/ ? '.exe' : ''), _delim => ($^O =~ /^MSWin|OS2/ ? '\\' : '/'), ); _set_progname(); _set_par_temp(); # Magic string checking and extracting bundled modules {{{ my ($start_pos, $data_pos); { local $SIG{__WARN__} = sub {}; # Check file type, get start of data section {{{ open _FH, '<', $progname or last; binmode(_FH); my $buf; seek _FH, -8, 2; read _FH, $buf, 8; last unless $buf eq "\nPAR.pm\n"; seek _FH, -12, 2; read _FH, $buf, 4; seek _FH, -12 - unpack("N", $buf), 2; read _FH, $buf, 4; $data_pos = (tell _FH) - 4; # }}} # Extracting each file into memory {{{ my %require_list; while ($buf eq "FILE") { read _FH, $buf, 4; read _FH, $buf, unpack("N", $buf); my $fullname = $buf; outs(qq(Unpacking file "$fullname"...)); my $crc = ( $fullname =~ s|^([a-f\d]{8})/|| ) ? $1 : undef; my ($basename, $ext) = ($buf =~ m|(?:.*/)?(.*)(\..*)|); read _FH, $buf, 4; read _FH, $buf, unpack("N", $buf); if (defined($ext) and $ext !~ /\.(?:pm|pl|ix|al)$/i) { my ($out, $filename) = _tempfile($ext, $crc); if ($out) { binmode($out); print $out $buf; close $out; chmod 0755, $filename; } $PAR::Heavy::FullCache{$fullname} = $filename; $PAR::Heavy::FullCache{$filename} = $fullname; } elsif ( $fullname =~ m|^/?shlib/| and defined $ENV{PAR_TEMP} ) { # should be moved to _tempfile() my $filename = "$ENV{PAR_TEMP}/$basename$ext"; outs("SHLIB: $filename\n"); open my $out, '>', $filename or die $!; binmode($out); print $out $buf; close $out; } else { $require_list{$fullname} = $PAR::Heavy::ModuleCache{$fullname} = { buf => $buf, crc => $crc, name => $fullname, }; } read _FH, $buf, 4; } # }}} local @INC = (sub { my ($self, $module) = @_; return if ref $module or !$module; my $filename = delete $require_list{$module} || do { my $key; foreach (keys %require_list) { next unless /\Q$module\E$/; $key = $_; last; } delete $require_list{$key} if defined($key); } or return; $INC{$module} = "/loader/$filename/$module"; if ($ENV{PAR_CLEAN} and defined(&IO::File::new)) { my $fh = IO::File->new_tmpfile or die $!; binmode($fh); print $fh $filename->{buf}; seek($fh, 0, 0); return $fh; } else { my ($out, $name) = _tempfile('.pm', $filename->{crc}); if ($out) { binmode($out); print $out $filename->{buf}; close $out; } open my $fh, '<', $name or die $!; binmode($fh); return $fh; } die "Bootstrapping failed: cannot find $module!\n"; }, @INC); # Now load all bundled files {{{ # initialize shared object processing require XSLoader; require PAR::Heavy; require Carp::Heavy; require Exporter::Heavy; PAR::Heavy::_init_dynaloader(); # now let's try getting helper modules from within require IO::File; # load rest of the group in while (my $filename = (sort keys %require_list)[0]) { #local $INC{'Cwd.pm'} = __FILE__ if $^O ne 'MSWin32'; unless ($INC{$filename} or $filename =~ /BSDPAN/) { # require modules, do other executable files if ($filename =~ /\.pmc?$/i) { require $filename; } else { # Skip ActiveState's sitecustomize.pl file: do $filename unless $filename =~ /sitecustomize\.pl$/; } } delete $require_list{$filename}; } # }}} last unless $buf eq "PK\003\004"; $start_pos = (tell _FH) - 4; } # }}} # Argument processing {{{ my @par_args; my ($out, $bundle, $logfh, $cache_name); delete $ENV{PAR_APP_REUSE}; # sanitize (REUSE may be a security problem) $quiet = 0 unless $ENV{PAR_DEBUG}; # Don't swallow arguments for compiled executables without --par-options if (!$start_pos or ($ARGV[0] eq '--par-options' && shift)) { my %dist_cmd = qw( p blib_to_par i install_par u uninstall_par s sign_par v verify_par ); # if the app is invoked as "appname --par-options --reuse PROGRAM @PROG_ARGV", # use the app to run the given perl code instead of anything from the # app itself (but still set up the normal app environment and @INC) if (@ARGV and $ARGV[0] eq '--reuse') { shift @ARGV; $ENV{PAR_APP_REUSE} = shift @ARGV; } else { # normal parl behaviour my @add_to_inc; while (@ARGV) { $ARGV[0] =~ /^-([AIMOBLbqpiusTv])(.*)/ or last; if ($1 eq 'I') { push @add_to_inc, $2; } elsif ($1 eq 'M') { eval "use $2"; } elsif ($1 eq 'A') { unshift @par_args, $2; } elsif ($1 eq 'O') { $out = $2; } elsif ($1 eq 'b') { $bundle = 'site'; } elsif ($1 eq 'B') { $bundle = 'all'; } elsif ($1 eq 'q') { $quiet = 1; } elsif ($1 eq 'L') { open $logfh, ">>", $2 or die "XXX: Cannot open log: $!"; } elsif ($1 eq 'T') { $cache_name = $2; } shift(@ARGV); if (my $cmd = $dist_cmd{$1}) { delete $ENV{'PAR_TEMP'}; init_inc(); require PAR::Dist; &{"PAR::Dist::$cmd"}() unless @ARGV; &{"PAR::Dist::$cmd"}($_) for @ARGV; exit; } } unshift @INC, @add_to_inc; } } # XXX -- add --par-debug support! # }}} # Output mode (-O) handling {{{ if ($out) { { #local $INC{'Cwd.pm'} = __FILE__ if $^O ne 'MSWin32'; require IO::File; require Archive::Zip; } my $par = shift(@ARGV); my $zip; if (defined $par) { open my $fh, '<', $par or die "Cannot find '$par': $!"; binmode($fh); bless($fh, 'IO::File'); $zip = Archive::Zip->new; ( $zip->readFromFileHandle($fh, $par) == Archive::Zip::AZ_OK() ) or die "Read '$par' error: $!"; } my %env = do { if ($zip and my $meta = $zip->contents('META.yml')) { $meta =~ s/.*^par:$//ms; $meta =~ s/^\S.*//ms; $meta =~ /^ ([^:]+): (.+)$/mg; } }; # Open input and output files {{{ local $/ = \4; if (defined $par) { open PAR, '<', $par or die "$!: $par"; binmode(PAR); die "$par is not a PAR file" unless eq "PK\003\004"; } CreatePath($out) ; my $fh = IO::File->new( $out, IO::File::O_CREAT() | IO::File::O_WRONLY() | IO::File::O_TRUNC(), 0777, ) or die $!; binmode($fh); $/ = (defined $data_pos) ? \$data_pos : undef; seek _FH, 0, 0; my $loader = scalar <_FH>; if (!$ENV{PAR_VERBATIM} and $loader =~ /^(?:#!|\@rem)/) { require PAR::Filter::PodStrip; PAR::Filter::PodStrip->new->apply(\$loader, $0) } foreach my $key (sort keys %env) { my $val = $env{$key} or next; $val = eval $val if $val =~ /^['"]/; my $magic = "__ENV_PAR_" . uc($key) . "__"; my $set = "PAR_" . uc($key) . "=$val"; $loader =~ s{$magic( +)}{ $magic . $set . (' ' x (length($1) - length($set))) }eg; } $fh->print($loader); $/ = undef; # }}} # Write bundled modules {{{ if ($bundle) { require PAR::Heavy; PAR::Heavy::_init_dynaloader(); init_inc(); require_modules(); my @inc = sort { length($b) <=> length($a) } grep { !/BSDPAN/ } grep { ($bundle ne 'site') or ($_ ne $Config::Config{archlibexp} and $_ ne $Config::Config{privlibexp}); } @INC; # File exists test added to fix RT #41790: # Funny, non-existing entry in _<....auto/Compress/Raw/Zlib/autosplit.ix. # This is a band-aid fix with no deeper grasp of the issue. # Somebody please go through the pain of understanding what's happening, # I failed. -- Steffen my %files; /^_<(.+)$/ and -e $1 and $files{$1}++ for keys %::; $files{$_}++ for values %INC; my $lib_ext = $Config::Config{lib_ext}; my %written; foreach (sort keys %files) { my ($name, $file); foreach my $dir (@inc) { if ($name = $PAR::Heavy::FullCache{$_}) { $file = $_; last; } elsif (/^(\Q$dir\E\/(.*[^Cc]))\Z/i) { ($file, $name) = ($1, $2); last; } elsif (m!^/loader/[^/]+/(.*[^Cc])\Z!) { if (my $ref = $PAR::Heavy::ModuleCache{$1}) { ($file, $name) = ($ref, $1); last; } elsif (-f "$dir/$1") { ($file, $name) = ("$dir/$1", $1); last; } } } next unless defined $name and not $written{$name}++; next if !ref($file) and $file =~ /\.\Q$lib_ext\E$/; outs( join "", qq(Packing "), ref $file ? $file->{name} : $file, qq("...) ); my $content; if (ref($file)) { $content = $file->{buf}; } else { open FILE, '<', $file or die "Can't open $file: $!"; binmode(FILE); $content = ; close FILE; PAR::Filter::PodStrip->new->apply(\$content, $file) if !$ENV{PAR_VERBATIM} and $name =~ /\.(?:pm|ix|al)$/i; # Do not let XSLoader pick up auto/* from environment $content =~ s/goto +retry +unless +.*/goto retry;/ if lc($name) eq lc("XSLoader.pm"); } outs(qq(Written as "$name")); $fh->print("FILE"); $fh->print(pack('N', length($name) + 9)); $fh->print(sprintf( "%08x/%s", Archive::Zip::computeCRC32($content), $name )); $fh->print(pack('N', length($content))); $fh->print($content); } } # }}} # Now write out the PAR and magic strings {{{ $zip->writeToFileHandle($fh) if $zip; $cache_name = substr $cache_name, 0, 40; if (!$cache_name and my $mtime = (stat($out))[9]) { my $ctx = eval { require Digest::SHA; Digest::SHA->new(1) } || eval { require Digest::SHA1; Digest::SHA1->new } || eval { require Digest::MD5; Digest::MD5->new }; # Workaround for bug in Digest::SHA 5.38 and 5.39 my $sha_version = eval { $Digest::SHA::VERSION } || 0; if ($sha_version eq '5.38' or $sha_version eq '5.39') { $ctx->addfile($out, "b") if ($ctx); } else { if ($ctx and open(my $fh, "<$out")) { binmode($fh); $ctx->addfile($fh); close($fh); } } $cache_name = $ctx ? $ctx->hexdigest : $mtime; } $cache_name .= "\0" x (41 - length $cache_name); $cache_name .= "CACHE"; $fh->print($cache_name); $fh->print(pack('N', $fh->tell - length($loader))); $fh->print("\nPAR.pm\n"); $fh->close; chmod 0755, $out; # }}} exit; } # }}} # Prepare $progname into PAR file cache {{{ { last unless defined $start_pos; _fix_progname(); # Now load the PAR file and put it into PAR::LibCache {{{ require PAR; PAR::Heavy::_init_dynaloader(); { #local $INC{'Cwd.pm'} = __FILE__ if $^O ne 'MSWin32'; require File::Find; require Archive::Zip; } my $zip = Archive::Zip->new; my $fh = IO::File->new; $fh->fdopen(fileno(_FH), 'r') or die "$!: $@"; $zip->readFromFileHandle($fh, $progname) == Archive::Zip::AZ_OK() or die "$!: $@"; push @PAR::LibCache, $zip; $PAR::LibCache{$progname} = $zip; $quiet = !$ENV{PAR_DEBUG}; outs(qq(\$ENV{PAR_TEMP} = "$ENV{PAR_TEMP}")); if (defined $ENV{PAR_TEMP}) { # should be set at this point! foreach my $member ( $zip->members ) { next if $member->isDirectory; my $member_name = $member->fileName; next unless $member_name =~ m{ ^ /?shlib/ (?:$Config::Config{version}/)? (?:$Config::Config{archname}/)? ([^/]+) $ }x; my $extract_name = $1; my $dest_name = File::Spec->catfile($ENV{PAR_TEMP}, $extract_name); if (-f $dest_name && -s _ == $member->uncompressedSize()) { outs(qq(Skipping "$member_name" since it already exists at "$dest_name")); } else { outs(qq(Extracting "$member_name" to "$dest_name")); $member->extractToFileNamed($dest_name); chmod(0555, $dest_name) if $^O eq "hpux"; } } } # }}} } # }}} # If there's no main.pl to run, show usage {{{ unless ($PAR::LibCache{$progname}) { die << "." unless @ARGV; Usage: $0 [ -Alib.par ] [ -Idir ] [ -Mmodule ] [ src.par ] [ program.pl ] $0 [ -B|-b ] [-Ooutfile] src.par . $ENV{PAR_PROGNAME} = $progname = $0 = shift(@ARGV); } # }}} sub CreatePath { my ($name) = @_; require File::Basename; my ($basename, $path, $ext) = File::Basename::fileparse($name, ('\..*')); require File::Path; File::Path::mkpath($path) unless(-e $path); # mkpath dies with error } sub require_modules { #local $INC{'Cwd.pm'} = __FILE__ if $^O ne 'MSWin32'; require lib; require DynaLoader; require integer; require strict; require warnings; require vars; require Carp; require Carp::Heavy; require Errno; require Exporter::Heavy; require Exporter; require Fcntl; require File::Temp; require File::Spec; require XSLoader; require Config; require IO::Handle; require IO::File; require Compress::Zlib; require Archive::Zip; require PAR; require PAR::Heavy; require PAR::Dist; require PAR::Filter::PodStrip; require attributes; eval { require Cwd }; eval { require Win32 }; eval { require Scalar::Util }; eval { require Archive::Unzip::Burst }; eval { require Tie::Hash::NamedCapture }; eval { require PerlIO; require PerlIO::scalar }; } # The C version of this code appears in myldr/mktmpdir.c # This code also lives in PAR::SetupTemp as set_par_temp_env! sub _set_par_temp { if (defined $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/) { $par_temp = $1; return; } foreach my $path ( (map $ENV{$_}, qw( PAR_TMPDIR TMPDIR TEMPDIR TEMP TMP )), qw( C:\\TEMP /tmp . ) ) { next unless defined $path and -d $path and -w $path; my $username; my $pwuid; # does not work everywhere: eval {($pwuid) = getpwuid($>) if defined $>;}; if ( defined(&Win32::LoginName) ) { $username = &Win32::LoginName; } elsif (defined $pwuid) { $username = $pwuid; } else { $username = $ENV{USERNAME} || $ENV{USER} || 'SYSTEM'; } $username =~ s/\W/_/g; my $stmpdir = "$path$Config{_delim}par-$username"; mkdir $stmpdir, 0755; if (!$ENV{PAR_CLEAN} and my $mtime = (stat($progname))[9]) { open (my $fh, "<". $progname); seek $fh, -18, 2; sysread $fh, my $buf, 6; if ($buf eq "\0CACHE") { seek $fh, -58, 2; sysread $fh, $buf, 41; $buf =~ s/\0//g; $stmpdir .= "$Config{_delim}cache-" . $buf; } else { my $ctx = eval { require Digest::SHA; Digest::SHA->new(1) } || eval { require Digest::SHA1; Digest::SHA1->new } || eval { require Digest::MD5; Digest::MD5->new }; # Workaround for bug in Digest::SHA 5.38 and 5.39 my $sha_version = eval { $Digest::SHA::VERSION } || 0; if ($sha_version eq '5.38' or $sha_version eq '5.39') { $ctx->addfile($progname, "b") if ($ctx); } else { if ($ctx and open(my $fh, "<$progname")) { binmode($fh); $ctx->addfile($fh); close($fh); } } $stmpdir .= "$Config{_delim}cache-" . ( $ctx ? $ctx->hexdigest : $mtime ); } close($fh); } else { $ENV{PAR_CLEAN} = 1; $stmpdir .= "$Config{_delim}temp-$$"; } $ENV{PAR_TEMP} = $stmpdir; mkdir $stmpdir, 0755; last; } $par_temp = $1 if $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/; } sub _tempfile { my ($ext, $crc) = @_; my ($fh, $filename); $filename = "$par_temp/$crc$ext"; if ($ENV{PAR_CLEAN}) { unlink $filename if -e $filename; push @tmpfile, $filename; } else { return (undef, $filename) if (-r $filename); } open $fh, '>', $filename or die $!; binmode($fh); return($fh, $filename); } # same code lives in PAR::SetupProgname::set_progname sub _set_progname { if (defined $ENV{PAR_PROGNAME} and $ENV{PAR_PROGNAME} =~ /(.+)/) { $progname = $1; } $progname ||= $0; if ($ENV{PAR_TEMP} and index($progname, $ENV{PAR_TEMP}) >= 0) { $progname = substr($progname, rindex($progname, $Config{_delim}) + 1); } if (!$ENV{PAR_PROGNAME} or index($progname, $Config{_delim}) >= 0) { if (open my $fh, '<', $progname) { return if -s $fh; } if (-s "$progname$Config{_exe}") { $progname .= $Config{_exe}; return; } } foreach my $dir (split /\Q$Config{path_sep}\E/, $ENV{PATH}) { next if exists $ENV{PAR_TEMP} and $dir eq $ENV{PAR_TEMP}; $dir =~ s/\Q$Config{_delim}\E$//; (($progname = "$dir$Config{_delim}$progname$Config{_exe}"), last) if -s "$dir$Config{_delim}$progname$Config{_exe}"; (($progname = "$dir$Config{_delim}$progname"), last) if -s "$dir$Config{_delim}$progname"; } } sub _fix_progname { $0 = $progname ||= $ENV{PAR_PROGNAME}; if (index($progname, $Config{_delim}) < 0) { $progname = ".$Config{_delim}$progname"; } # XXX - hack to make PWD work my $pwd = (defined &Cwd::getcwd) ? Cwd::getcwd() : ((defined &Win32::GetCwd) ? Win32::GetCwd() : `pwd`); chomp($pwd); $progname =~ s/^(?=\.\.?\Q$Config{_delim}\E)/$pwd$Config{_delim}/; $ENV{PAR_PROGNAME} = $progname; } sub _par_init_env { if ( $ENV{PAR_INITIALIZED}++ == 1 ) { return; } else { $ENV{PAR_INITIALIZED} = 2; } for (qw( SPAWNED TEMP CLEAN DEBUG CACHE PROGNAME ARGC ARGV_0 ) ) { delete $ENV{'PAR_'.$_}; } for (qw/ TMPDIR TEMP CLEAN DEBUG /) { $ENV{'PAR_'.$_} = $ENV{'PAR_GLOBAL_'.$_} if exists $ENV{'PAR_GLOBAL_'.$_}; } my $par_clean = "__ENV_PAR_CLEAN__ "; if ($ENV{PAR_TEMP}) { delete $ENV{PAR_CLEAN}; } elsif (!exists $ENV{PAR_GLOBAL_CLEAN}) { my $value = substr($par_clean, 12 + length("CLEAN")); $ENV{PAR_CLEAN} = $1 if $value =~ /^PAR_CLEAN=(\S+)/; } } sub outs { return if $quiet; if ($logfh) { print $logfh "@_\n"; } else { print "@_\n"; } } sub init_inc { require Config; push @INC, grep defined, map $Config::Config{$_}, qw( archlibexp privlibexp sitearchexp sitelibexp vendorarchexp vendorlibexp ); } ######################################################################## # The main package for script execution package main; require PAR; unshift @INC, \&PAR::find_par; PAR->import(@par_args); die qq(par.pl: Can't open perl script "$progname": No such file or directory\n) unless -e $progname; do $progname; CORE::exit($1) if ($@ =~/^_TK_EXIT_\((\d+)\)/); die $@ if $@; }; $::__ERROR = $@ if $@; } CORE::exit($1) if ($::__ERROR =~/^_TK_EXIT_\((\d+)\)/); die $::__ERROR if $::__ERROR; 1; #line 1012 __END__  h o  ?ppooo?Ƙ֘&6FVfvƙ֙&6FVfvƚ֚&6FVfvƛ֛&6FVfvp[GCC: (Gentoo 4.4.4-r2 p1.3, pie-0.4.5) 4.4.4.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment TThh %!o0+ 3;oHopW p` pp ihhdo,uH{H^ l'l? ? ????@ A 0-=ELF34g4 (  #33BJ7GGPtd   QtdRtd#33||e(XgGZGv,3q ct(P3)0Fz9@QST)mYy<oSKtNkUjnv% NvufY ;D~B%2Tkui h=i45bf&OD,wjc<53uO`]K&73@8]wTJ3$xBm/?lBmT'choA7}KXo-)u"=/=]y{^;6MF*A:<@\HP/PL@O=> 60 Z:lS%$~*~F'pZ= I9P. (;s}S&|m" q} 4P_z\)xS5V"'bi1zPCDQJ  i)o?)wA(Ef{0B@viiq*7Ms<J?  NMUopDu$O6\(g>z %s3 8+Z/[!| TC#<+2A].Ul,^Vj9'sL,zd|;#|<(- w'h?wnJKXH }q>NInJ{QO-Ol{UC^=5e)rGue/){;\f+Fm5R*nwXyM<H9  !Ijj5Nr;H;Kd?:D !|0&LI_EeRr,&[bUlVx$7H@(&Ka9++e[>CFWm.RIR!-^V9#t;(/WI#cIpg1t&T6OEdqY-YdJ.y78A 6zbDH.^!g;EBcPW".ya1 $h#>W yCG\G/7}|wv:{ NFcyaa_!GQ4r'mR1L:vrxH_:X[aL6.iEY'B}<DV^:QQlfe!fQR0O>U4 Xv}1#TLS[at]% ^8>[li1cU +s?zrs_N-$qJ6&Cwfm1zK'JZho2tk5x d?kN-qg*a ["<BVX}beb`R?8x $ek3k3 VHb+t]xokpYEk7,o)FK! 2 1n{|*%GMI_g~Zgs`OWZ`&>w8uHdW[2eN~]zTj."g*v~M`rsTq xW/yB 4j\`=E2AD0`12|:*229d~b$pZY tXrYLop6S4@5P q{A$-FUu`KGlhj ba\-E6_ ~^Rcg!j# 0h0c:L8FB+48D_eC`7~yma{ d'MGpt(Cn  E\[}f3\4._",rX45^YkQS# @>%vWC@  MAAln,uULpM"%W= 9S%|n/np*Z#("J=7+ x?Vh]i,Qf h dIR]8P0Vs9 #8 ЁR @3( @"Qx @Ał*HP  H!P l@2z *" (@$i q @h%@ $%Aa(-3@@ (A A'I10 $$D@X#8#A1 4 B-ب1@00 !A @$<@F X ` AP$H A %D6ET- a8@!1K $  + !Bl(L@  A .("P`b$@d"ZA 0QHT@P q  #'`GBt6rP H (( @@@Q"@ 4@8@Dt J8@ȱ@@iA D(BR c""@1h 0, ""@*rDD#=JsT!M"@@A%A( $@Xc $)!2 @D `-D "D@  IH lr%A$ H!@s1$g0b,bP@aB48T\ H$2 @  $a )@j 0 8 $d&E $ P fhRA1$ `,!PR@FD ` B$Pd@,  R) @!h` d "aPH@D:P MAX PF " @I  0@A 0LP:0 @` B&"" @ Paa@ e N"a11h()(0G!!` ,"`'8EN# eL&( P 0nDM m["F"H!( lK`@"D@!Ԣ,0)` D\! pD Q$ R) B I@w@E,P(1* B&(`*#@"<Bp@a1A  0#(@0$9)# H@ R֨a P D@H d@P FTp  dBT!JH9 (@M5(8@1 @ 1h(-%QB@Qx @83d%\K`0$T r@  @ P00 & @A(E*A  A  @(d  )@̄F@A`2!@9%.P@ 0 B(GZc Fz /@R@  #&(*,/358:=>ADGHKOQRVZ]`cefgjouvxy|~     "$&)*.23459:=?CEFHILOPQRTUVYZ[\]`acgjmoprwx~   !'(*+.0348:<?ADGJLMOPTV[]abdghjnorsuvwy}~     "#%&()+,/01479:<>ADEIKLMOSVXY\^_cdfijlopqrty{|~   !"#$%),-./0124678<=@BEFGHIKLNQRSTUVY^`cdfijmqtuvx{|  !"$'*+,134578<=>?ACEGHILNRUVXY[]_`adfhknprtz} #(*+,-156789:>?ADFIJMORUWYZ\_acfjkpquwyz~  !$&'()+.035689<>?BCDEGHKMTW[^`bcegkpqtuwxz},bU) Js e8 hzߕ'T(-;]jEhp*6)dD;U_ `K'RّJY81ZL]D^ ߍ`amM[N, #wG;SbOnq̫VpKQpz^G)Ǯ(x3}Pvh& ˖s ?A\HXiuj*|$HӄpݙR!߫ʟٻ,3 O!&]l%i4@dJ;/@ H0SJf6  acyנGtހd:)k[a sF ٫Wd"$bi o+c 2iڲKT8j<ڂ"nz%,SB}ލq hm٘Lxv`2 e Q'VZ̩ga[2m:a@[H)A1q!d#_K_;IipyHlFm6gaKQb*JII6İҥL 飪KCԴ$(9MLhx핿aTWz]Ǟڅr[iID@ m64!uq}O῀OұGb/ l2SC~[OG5yn|K>EL._`YIӞe(n;`"/uh.jgc.E>o+C0\m.`;@83DHYt|Lj_5/c =Sː#t)=]%N@6!es͉ 5 1o*b`W#j_LGg&e9?BDX;@0#G-nHF"eCuE}Lj}_+!a*5 HӀB=<\;QHWݧ; ҥ+咜:\F_{9zc}6ELTk:WrC(hv,v>ƿRHj=~h}u<=EF/DY9wdZRr9PuS7 x~ Zha0]TVX>WY\˟J7"8{Cm$J³(b)\_B%s|Ygo*J-|Ms)V[o7L'g55\!NY̛Y@e}+VZR,7^5l}hK4j E~p13AS$S(O;}W}6&P$ڙSah 0L_n? ๺ %l5 &)-:/cNk][JJs/qXIZ8Tz`r JI>X-62cjWp>s69':R(If!@t5U\u͋_Jg l7.2G$Hjo^Q/AO7ɏFJX։}hJ2VYn-}((.}w.ϥYWԛC&ãtA1+#Q84+oX. [6l,;뢹 7}n'9}+;} v|~Y_rH͔AbUojm!Yל@k4;aoŋkjcQXM±mh. 3"QiG_6}9J3xF~R5HhU^0<'x}j{ɮsgQik̀TgaeDn Mxj|!Nt QT-sPQ,NC s~:̉Nٴ+Ṹ)򭺧2;oͿ˪7 iWblo1vD# O(7DǣZdI iefKNd nz6h)ĉkMt@^Hr6} ,Cg&Z8`to*͗iu<}iMhtr~`3'|[5V0Q]Y=9AJHH>Q;S,𛏎l<G?ӌ_CmsPnL廀T$l[U0IF 7h%4;'\Aǒj*Jk o\7i"WI%p@F$p(ek(}_,3fO#lZ&D"޹94AgamK y3CaдBHO@NJ|_jPA?xTGveVf) GUIVYdDO5MHO8XD<0VC \" ԣzFK%m L:*'ҩ uWY?<ŧ߽7wH +~q+P8uz="!|  "=1H9YTjsK|OOkW*S[EL2]UOx=sB4ت7E>:=#AXk85Z6h`J_ZREyzPļ3!VnPnɞH"i߉ѫF*D198ۼKOW?oEo{<+q\aY^*ZHbUI}ܓ͖2RG˵haQ}_BϾ+ҍ.ChsO̶e2LQLO6e.gkt:j'+ǒ=Y}BC@WiDZMuΉ3«7Ikys7Z@HUeC`A4Ͻ>$^ L\'y<;!Zu= 㲥`EXy5Ve΀)cq =y|0kx`\݌ (7+B5WJ /WnAkFn nZa,⿚l 鄾]l \}[+*q# ?VHn FTۏ}> s|m*R}1&)Kl#O}k;{ sbL ErYg,_izWk2:?Uy=Plpaz`/WnrP(J T֦⍸O.ڰ]I3Z 7؉LYIoY9 $~k/&W™):1~/WntueC-wRM\ldԛc~P]Ad(VM֌_7\=_'hD*(0qqKksK!yw2\A70m3`{TiBD_ M^CDeOnqYgĝ^LE KY1I@N;8OyڅMpn+ʱS#GsJ~[<=.?E.dS;j $>ha0] !+ʺ(YlP3 >(+^X7iokN V YW H:_K eRF~U>Gq.Xn5G7WT;vVQm_+c'aI\n!J ܟS9zJkq(a./BDu{@XfQF#+bڗÔ7csU'Z~Y&EYl[91lLkIYMVR4m>CjFMYQ@Y{_QD awQjFvym&L\;iZ.lY jFӚ]2ZY3MQ6 x&lj޻JILB+V5 .AJ+lV&CWqUsxO;ׅ O(+sv{JwE qڦ{.a<1ޅ O,|8N78LRں92_bFL%UU8 k!Z`9cFtRhX "yY.V$@<x9K:.I1h=Pdr@^/N$تXM6"g[F |tYHTx]3r/Kzt,R]Iԇ:FFQ(cgPG|&©0M,7eԛ!I.XABg4 V(˟MI \Ύ|]"}ΎpEיִgbn4m.lE;QrJYf' 2[m1GWw̃>Wmmm7>ӣY<1.¢Fkr󗙤])ϽYk _*z H 7Hsi*} 'lc 'X r85]fp ;Lh{}6T9Snnj뫄\b7w3K' .4w$yA)rha \jc봶(D YXN[f2>9l ԟ8I[Lgf6L*z)Bҫ{]nY$m_2 fDJdm:Yl&NQFKDFPֶQծSD.El\PySq!VzΎ};JԜBD&(_^njRЂJ@:Gv" vd}Akm&1Z<Y7ZTϥUޱ,tir k!ݜE>mg7 DIsTA&BnG#_I$Vhl2 LڗgVNJg*&_F{:Y65I3?HC׌[r7ZDZ:uI6CE6ԣ7?Y__FOKf/4[N2]ֹyfu1U@F\P~}Yl10grq@`,;ֿh4L `KMs(LrYnE?4M'ʿh-ؤݚ!shSȞ㐣ѻ*Nk?VUT4Z[=}~=0X46Zz 63 h0Y(s4F zUnS % 855)zTSs4}T 6TTr\\m5([VNY~\X~S,sU T\)#~3m'xU6e=&|Vvj4@UtK1yIBBzU.Wx\qY!V~jZB4VlvXYwRZ5Z+7$WY[-omWEr35UW(6\UvS\V5x;TVW&W&UlmmkX~\q6Z/UrT%rSWtNmWpYFnU0RViZ}58TUzX7yTFW;N"X~.!NWSV8>XVKu=5KV#[4vW<YUzSDZ\k<e(-_KOX)ksxXfmYm=5 xk\2T/NY V?[l)T\c#- NU"S\%szM*@zg'K B@| 1  * A {< & 3S  @8 c@# CvG" X t- Z v w @*  rwp  1 q:Pu i B`) p`rpg  xyO  t) { xw X|`huarC 9 q@yw 35`* nXr S L V > Z ( i.' h}T0 j `#  8zq hx+ Jg ~ LO <  a1 j  {8  7M 8yg# . P 7- %f@ y^# P@ KP8`(i, 0 Z m P! A R 0{Np  '  I 9Z @D i 9A? FY O ep{  AY  ql`J M.PV pQ(  nPX% ug/ 4|UJ@ - xy B  ~0i }c_ l@K0 q |aKO FY lh `z\X h{kN  i>p4 I i @  /4 w3` 0 W lJJ @$ i c0_ v ` 0g  8` v& 8Y rmN@ f0  2w +O  h + GЗ A N  ` i {(X`_  7P2 f84W ;i ::@L :~@n {в5 N ^ mk < d| t|{9 vD c 5 gPQ <@|  p!4{0z Bv'Yi {x z C@# L04 !|=8p3* fG A h `) ]xMDzFm  $w  ND 6 5 (yLzvR@  ep y|hta#  P 1 Hb_ :@[\ Pp  7`' AR s GL J)С Xf { =p| Hp r [A 8|x{f|JZ # 1`n }xI  lL( 7f "R? SA }y /lFc Gp o UR|B`( ( nar~6 w 0 | i )  u<  f  =P  R  @6 |r0U g@ '' yx?4 b  *:f  S@ 5 TalA?  Ja   h pqS s: \Hq5B`P  YЎ  vh ;0iG  `0zom>9CI v 1}`a`1 psprP p oF '    E`  o_ *<; ?|xY@  B' f {=  x  0 yip. o iv a%Ј  ZxP #F0 A H @   ,{FVP\r _L_ { # k+ P 1 !S  Rw x#  {2 -{ D  @Q"  MЎ _ J`#  *p  ' 1 0 90~  #@(; v.0S L`f % 9I04b E B 6 Y )  |1 o  zip/ >` %@q wz g! 9+F. vj|{\"`p (=v z,w71y MI4W Z  ,]0-4 &j/ ob`_ E*; 7V+  /4   f% n@0 } )@ 6`|  I@ 6   r //hQ &nT !x0: P#) Nxe@ y2 }p Z  upX Z0r 0P+ 5)|Cxx 3 o_6 :G J  8d '# wD  O 7 Xt$ z|{0C 7) [t  8*  o0mu kPA MP = $C  , {.]i p `s@ Rb ? \+ MN0 E ^) y9  ,/ [yp |{\0< :{J`'  ~60+ X,, P d %%  P@h B  ~{n[ m`f |2 1@ f@ U[ W $/F QD  U` ) :0S & i c #qs4 9E% 1 x]O RzP P g 9|j ?7 Y GJp  AN 3 xv0 A1    Ћ @y0+   ~x?b IH0  2T `4 $0 ~6k 7aK R*; $0Y Cw ]zpp )xzXd@[ @k9b k 7T ppo rXe  |qPr b_ 8|x{4@} vp uP9 1`o WA 5{A 7R0 # >0 T q |3 .y 4 Pap|0K Eopan 3 g@( ,M m0L( x M = w ~@9 a1 4 5t G H {XPx g^  m Vyu0f 'Z n{A eP  -P} E  } R  f z= B }I [ M&/+ h|y O  u i 2e I1m * r@S H Z !@ E "<kb hr v5  S@ L (VpX O Z -`j h2p [  [  1n spj h`P) mP) hgJ zN  A%PNk< LQ %  t# A. c f % = v,0g  \ h -Q@"  @  "" >0 b Ue tz#v qz Mps - 6$$8 Lh % 5] -`   `) S L '  2 *pma ]}P+ /P( s}+ } _) S + 3/ !1`m  @* h ]# @1 =ePg xkE g+ C/0l 2o '$ uP- Q Y  p$` .Q[ L k % ".XzAsЕ fP$ p *  )  YHp { ~qud 9O&x H Z{af (I,4 g! <D p U$  1'@ nR 9pDn RvP 1 x/e^ k7: +p WV  -1m <w ?v9  EH U j ? m tj 0t K* g @ h|w0 O0  U'  Fz4hwX3E mm7, 04`d ?R [M  ;z\  .P>8 xpz`|WY 5 % R   E M C  2 q j = @3 F};TzJ`  9 qM  p yP H} + Um0M P 7 su^ @# i KD < 2A? _z b({P8  1 6<lZ {_: rk<L i+  F! } 2 WU  L0e % {8 {p`qp){62@p u? 9}9 LE  }`2 X{-G,;= `Y0  ,zUoaZ C| J Cp  UG A P_ [ B uл2 Y  j/ ``) un {V*  x6 p 6Xa U 1o [0 > |+ K= | fR  -l lpK( " /n XZ  2; 3p nF! hc# C  *||2 {9 1n |!U + B VR U wZ  2: G K *?N Z  m Q` h/5 $U  lK( d` Qk@:( 8A* " PX cpup<6  kB nY q$.u }0- kP"9 ^F` ^ AN  " ! t {ЇZ D@P q{ Y0   ` H  ^p) '> k>< W!p \N  Q / aC q} a$PR  0 C@  ( y tVPW +#  0p. #O d]/ vS  ~O  -  _P K ?  Wp`upN`  uк? G A nSm vP +GU N%P) F , Mtд$ 91  x}L=R &} ( m\ Ir8 `-wm 2@e ^XxVO  mPN !P`  rІw o0c Y G `) fzp 0(  , 4z._ Dq{[ 0 I@3 bP# *0= :W9 x3%p ^ H9B xp e 3Q jv ^aP2 C\# (9 Bt$ {[  au` PUc cO,J S{ \ zWP  R , AU  |> sБ j#0 E \ AU  07{G I  IP D s ppp5 H0    <~ =n vy pRx z B`z  {`) `A '@ 1 r` Nj/#  ^lI 5 }u9 x cwP M WS P$(  S@  B0 ( +` =`$  f  j5 R  "l I - vZ`q vP  , Fp @-  AL`R  6WF  vVcP_ { 5 '9BC 36E  5# l Ft uf bJp  K6 ?P p| 4yO0  Gu d@6 7vM T-txt+ /c_ }/[  [` rzSP m B X^ Y Kp,  = 8A v fM@  T{3o !  1. H 46 (-@`~а m X5b u"` x 5 ~Q*  , f1m Dl}i.  M @ P  G @P 5Y{ 1 5  Ep  +J "@ z3NP  KC |M  i. ]x CP v f  Wvо2 d|J )p,f .` l|n@_j ]p}  IP 5 {f?@B F  v ~\}xx s0$ cvLprp b# Ac # T   r6P% tP+ V7  =Mw y |P1 F`Z  % &$P"? vFp~ < H|@F )||A ixp 6* Bz  J-\xTB oEyZr SP{ {+ zp R3  v" pyvN7TM M 1 qa R ?  Qx b!0E  z eQ 1 t+ \\{S L @,K s5  aE}v0 O ( r`| '}9 N  go s@j N; be *, /s :W] {`D K uZ  X/  @r 3@n {0P C{; I  zRP  '` 2 /(p;g r{ [@ & 8 pj 0p6 h[  v/@ 0н p 0 )E@  &w h`sE { #  :@W& K1  Qu H{>0 t + A AL{P4`A p`tp[ p q @ 2 ;j ^A= - !@ [ @.  ',pK\ v3e L`c  lF2 Cg0 |^W0H u ly `  1 n g <{wKO #p Kp7 0 <^y( yVC  ]# r'0 >|j1 nD   )803= [>@ _@ M h0y<@UU R  ct0+ MXaxd }H[ ( !b@_ P   !x[P s{|" [ nP\R )P 0v o`eu (E ' 3 X2p VA S X0k  ({P3 n T j GP v wp d{J  9?@ In0V \| 0Hxj6E bp# "] b& #}  ya9F w   z C "a7 f "m`L= 0@ depq `18 w1n G{" |[P h aN ?{N(s M 7] Zb0# @W c kLj ]Pm \ L:`_  E e (P |@ P WE  v   (  k= Y U z;b> /0D ]p_ Q`@ Z   N  }Fsu z `aM+F >]p-, v9 llada}+ v QP@  " }eq $1 {"@ rp~ .a& qt`+ wP !`|VK01 ; vG J L|X\ s @5v  "` u W^\zm Fw D B P`  |Mh wNWG  HPv#vp W`T _ Iq`tT wG c P5  {y  y 0>@ )0PS %Hr |wkDn C@ a 4p, 1@m {D0  t+ t7 i0/: og  O8 J$  yPp ' 9e  vVB N gA &пK DT0 q /`) y0 WW 5 3 v ? I^{~ co@bg x {P w 4 x>y@_zE2`p \U"  1" 3nU .`_ a0N .^  y  3 @8 < b# kWJ @ 5pn 8D  S|J x 7# h RE{C x 8@@ 6 k ^) |@> z ]yv> pV tG I`IC j2\ 0t  {I0_ cXd  #_) @H d3@ 70 p "K`O @4 ^P)   .@   m,N 3z My DaD0  Y <Z 5 (vn -7_* ; vf 7 3 BwLxSU e J2   pB b;0" w G0 z GXpb V SY@  Jp  s(  g`@ &r@ $/ !}LyP @p`spU @ /b -Z0 ! 5$ywR  c_D X` HR` Z P]3q __gmon_start___fini__cxa_finalize_Jv_RegisterClassesPerl_op_refcnt_lockPerl_op_refcnt_unlockPerl_sawparensPL_sv_yesPL_sv_noPerl_cv_const_svPerl_ck_concatPerl_ck_nullPerl_ck_svconstPerl_custom_op_descPL_custom_op_descsPerl_newSVivPerl_sv_2mortalPerl_hv_commonPerl_sv_2pv_flagsPL_op_descPerl_custom_op_namePL_custom_op_namesPL_op_namePerl_sv_newmortalPerl_gv_efullname4Perl_newMYSUBPerl_save_pushptrPerl_croakPerl_messPerl_qerrorPL_ppaddrPerl_formPerl_yyerrorPerl_ck_matchPL_compcvPerl_pad_findmyPL_comppad_namePerl_av_fetchPerl_ck_bitopPL_hintsPerl_ck_warnerPerl_ck_rvconstPerl_gv_fetchsvPerl_sv_freePerl_sv_free2Perl_ck_anoncodePerl_pad_add_anonstrrchrPL_scopestack_ixPerl_push_scopePL_compilingPerl_save_sptrPerl_save_I32PL_beginavPerl_av_create_and_pushPerl_call_listPL_curcopPerl_pop_scopePL_endavPerl_av_create_and_unshift_onePL_unitcheckavPL_main_startPL_initavPL_checkavPL_markstack_ptrPL_stack_spPL_stack_maxPL_stack_basePerl_stack_growPerl_op_const_svPL_sv_undefPerl_newSVsvPerl_cv_ckproto_lenPerl_ckwarn_dPerl_sv_setpvnPerl_sv_catpvfPerl_sv_catpvn_flagsPerl_warnerPerl_block_startPL_savestack_ixPerl_pad_block_startPerl_save_hintsmemcpyPerl_mg_findPL_curpmPerl_safesysfreePerl_op_freePL_opfreehookPerl_op_clearPerl_refcounted_he_freePerl_cv_undefPL_comppadPL_curpadPerl_pad_undefPerl_newXSPerl_gv_fetchpvPerl_ckwarnPL_parserPerl_newSV_typePerl_mro_method_changed_inPerl_gv_fetchfilePL_curstashPerl_newXS_flagsstrlenPerl_safesysmallocPerl_sv_usepvn_flagsPerl_sv_setpvPerl_savepvnPerl_newCONSTSUBPerl_save_vptrPerl_package_versionPerl_gv_fetchpvn_flagsPerl_sv_setsv_flagsPerl_packagePerl_save_hptrPL_curstnamePerl_save_itemPerl_gv_stashsvPerl_newPMOPPL_op_maskPL_checkPerl_ck_ftstPerl_gv_try_downgradePerl_pad_freePerl_op_nullPerl_peepPL_opPerl_newSVpvn_sharePerl_hv_common_key_lenPerl_sv_2iv_flagsPerl_refcounted_he_fetchPerl_gv_add_by_typePerl_scalarvoidPL_opargsPerl_scalarPerl_sv_2nvstrncmpPerl_newSVpvfPerl_dorefPerl_oopsHVPerl_ck_warner_dPerl_oopsAVPerl_modPL_modcountPerl_pad_allocPL_eval_startPerl_save_pushi32ptrPL_hintgvPerl_mg_setPerl_ck_returnPerl_newPVOPPerl_newSVOPPerl_newGVOPPerl_ck_methodstrchrPL_warnhookPL_diehookPerl_create_eval_scopePL_sv_placeholderPL_top_env__sigsetjmpPL_runopsPerl_pad_swipePL_errgvPerl_newSVpvnPerl_delete_eval_scopePerl_mg_freePerl_listPL_tmps_floorPL_peeppPerl_pp_pushmarkPerl_pp_anonlistPerl_ck_sortPerl_newOPPerl_block_endPerl_pad_leavemyPerl_leave_scopePerl_newNULLLISTPerl_newBINOPPerl_newLISTOPPerl_ck_repeatPerl_newSLICEOPPerl_prepend_elemPerl_newSTATEOPPerl_intro_myPL_perldbPerl_store_cop_labelPL_debstashPerl_append_elemPerl_append_listPerl_scopePL_taintingPerl_newUNOPPerl_newSVREFPL_defgvPerl_newCVREFPerl_newHVREFPerl_newAVREFPerl_newRANGEPerl_sv_upgradePerl_ck_listiobPerl_newPROGPL_in_evalPL_eval_rootPL_main_rootPerl_get_cvn_flagsPL_markstack_maxPerl_call_svPerl_markstack_growPerl_invertPerl_newGVREFPerl_ck_smartmatchPerl_ck_readlinePL_argvgvPL_stdingvPerl_newFORMPerl_pad_tidyPerl_newWHENOPPerl_newGIVENOPPerl_sv_2boolPerl_newLOGOPPerl_newCONDOPPerl_ck_sassignPerl_ck_evalPL_cv_has_evalPerl_hv_copy_hints_hvmemcmpPerl_pmruntimePerl_newSVpvn_flagsPerl_pregcompPerl_utf8n_to_uvuniqsortPerl_uvuni_to_utf8_flagsPerl_swash_initPerl_bytes_to_utf8Perl_newSVuvPL_memory_wrapPerl_bind_matchPerl_ck_splitPerl_convertPerl_newANONHASHPerl_newANONLISTPerl_jmaybePerl_ck_subrPerl_gv_fullname4Perl_dofilePL_globalstashPerl_ck_funPerl_ck_eachPerl_ck_substrPerl_ck_unpackPerl_ck_truncPerl_ck_chdirPerl_ck_joinPerl_ck_selectPerl_ck_rfunPerl_ck_definedPerl_ck_lfunPerl_ck_indexPerl_fbm_compilePerl_ck_grepPerl_ck_existsPerl_ck_execPerl_ck_exitPerl_ck_diePerl_ck_deletePerl_ck_shiftPerl_ck_requirememmovePerl_sv_force_normal_flagsPerl_ck_openPerl_mode_from_disciplinePerl_ck_eofPerl_ck_spairPerl_newATTRSUBPerl_sv_setivPerl_sv_setpvfPerl_pad_fixup_inner_anonsPL_sub_generationPL_breakable_sub_genPerl_newSVPL_sublinePL_DBsubPerl_sv_cmpPerl_sv_catpvPerl_newANONATTRSUBPerl_newANONSUBPerl_newSUBPerl_utilizePL_cop_seqmaxPerl_vload_modulePerl_lex_startPerl_start_subparsePerl_load_modulePerl_ck_globPerl_newGVgenPL_glob_indexPerl_newSVhekPL_incgvPerl_newRVPerl_pad_compname_typePerl_my_attrsPerl_localizePerl_apply_attrs_stringPerl_newSVpvPerl_newLOOPEXPerl_savesharedpvPerl_newASSIGNOPPL_generationPerl_newLOOPOPPerl_newWHILEOPPerl_newFOROPPerl_allocmyPL_defstashPerl_pad_add_namePerl_nothreadhookPL_e_scriptPL_curstackPL_mainstackPL_curstackinfoPerl_dounwindPL_stderrgvPerl_PerlIO_stderrPerlIO_printfPerl_my_exit__longjmp_chkPL_statusvaluePerl_my_failure_exit__errno_locationPL_statusvalue_posixPerl_get_hvPerl_get_avPerl_get_svPerl_init_dbargsPL_dbargsPerl_av_clearPerl_init_debuggerPL_DBgvPL_DBlinePL_DBsinglePL_DBtracePL_DBsignalPerl_init_argv_symbolsPL_doswitchesPerl_av_pushPL_unicodePL_utf8localePerl_sv_utf8_decodePerl_init_stacksPerl_new_stackinfoPL_tmps_stackPL_tmps_ixPL_tmps_maxPL_markstackPL_scopestackPL_scopestack_maxPL_savestackPL_savestack_maxPerl_doing_taintgetuidgeteuidgetgidgetegidPL_uidPL_euidPL_gidPL_egidPerl_my_unexecgetpidperl_freePL_veto_cleanup__xstat64Perl_sv_chopPerl_sv_magicPerl_av_lenPerl_av_unshiftPerl_av_storePerl_moreswitchesPL_preambleavPL_unsafePL_minus_lPL_ors_svPL_rsPL_dowarnPL_patchlevelPerl_sv_derived_fromPerl_vstringifyPerl_PerlIO_stdoutPL_minus_nPL_minus_FPL_splitstrPerl_grok_hexPerl_sv_growPL_origargvPL_inplacePerl_parse_unicode_optsPL_utf8cachePL_minus_pPL_minus_cPL_minus_aPL_do_undumpPerl_grok_octPerl_my_setenvPerl_upg_versionPL_bincompat_optionsPL_localpatchesPerl_eval_svPerl_save_intPerl_taint_properPL_restartopPerl_free_tmpsPerl_require_pvPerl_eval_pvPerl_get_cvmemchrPL_toptargetPL_bodytargetPL_formtargetPL_taintedPL_origfilenamePL_envgvPL_ofsgvPerl_PerlIO_stdinPerl_setdefoutPL_statnamePL_origargcPerl_hv_name_setPL_replgvPerlIO_fdopenPerl_PerlIO_filenoPL_statbuf__fxstat64Perl_rsignal_statePL_doextractPerl_sv_getsPerl_instrPerlIO_ungetcPL_taint_warnPL_minus_EstrerrorPL_main_cvPerl_pad_newPL_isarevPerl_boot_core_PerlIOPerl_boot_core_UNIVERSALPerl_boot_core_mrogetenvPL_signalsPL_subnamePerl_yyparsePerlIO_binmodePL_defoutgvPerlIO_openPerl_filter_addPerl_find_scriptPerl_gv_checkPerl_rsignalstrtolPerl_savepvPerl_filter_delPerl_call_atexitPL_exitlistlenPL_exitlistPerl_safesysreallocperl_allocPL_curinterpPerl_sys_termPerlIO_teardownPerl_sys_init3PL_sigfpe_savedPerl_sys_initPL_DBcvPerl_av_shiftPL_savebeginPL_beginav_savePL_checkav_savePL_unitcheckav_saveperl_runPL_exit_flagsperl_parsePL_rehash_seed_setPL_origalenPL_basetimePL_origenvironPL_use_safe_putenvPerl_get_hash_seedPL_rehash_seedPerl_call_methodPerl_call_pvPerl_call_argvperl_constructPL_perl_destruct_levelPL_scopestack_namePL_errorsPL_chopsetPL_dumpindentPL_maxscreamPL_reginterp_cntPL_watchaddrPL_regmatch_slabPL_dirtyPL_maxsysfdPL_sig_pendingPL_curcopdbPL_gensymPL_laststypePL_laststatvalPL_profiledataPL_in_clean_objsPL_in_clean_allPL_anPerl_runops_standardPL_evalseqPL_maxoPL_amagic_generationPL_collxfrm_multPL_collation_ixPL_collation_standardPL_numeric_standardPL_numeric_localPL_perlioPL_known_layersPL_def_layerlistPL_encodingPL_sharehookPL_clocktickPL_in_load_modulePerl_sv_nosharingPL_lockhookPerl_sv_nounlockingPL_unlockhookPL_threadhookPL_hash_seedPerl_sv_destroyablePL_destroyhookPL_reg_statePL_NoPL_YesPerl_sighandlerPL_sighandlerpPL_start_envPerl_init_i18nl10nPerl_set_numeric_standardPerlIO_initPL_fdpidPL_modglobalPL_debug_padPL_strtabPerl_hv_ksplitsysconfPL_stashcachePL_mmap_page_sizePL_osnamePL_registered_mrosperl_destructPerl_my_fflush_allPerlIO_destructPL_sv_objcountPerlIO_cleanupPerl_PerlIO_closePL_sawampersandPL_statgvPL_lastscreamPL_screamfirstPL_screamnextPL_efloatbufPL_efloatsizePL_argvoutgvPL_last_in_gvPL_argvout_stackPL_collation_namePL_numeric_namePL_numeric_radix_svPL_utf8_alnumPL_utf8_asciiPL_utf8_alphaPL_utf8_spacePL_utf8_cntrlPL_utf8_graphPL_utf8_digitPL_utf8_upperPL_utf8_lowerPL_utf8_printPL_utf8_punctPL_utf8_xdigitPL_utf8_markPL_utf8_toupperPL_utf8_totitlePL_utf8_tolowerPL_utf8_tofoldPL_utf8_idstartPL_utf8_idcontPerl_sv_clean_allPerl_sv_clearPL_sv_countPerl_free_tied_hv_poolPL_psig_namePL_psig_ptrPL_psig_pendPL_formfeedPL_debugPerl_sv_free_arenasPL_mess_svPerl_sv_clean_objsPerl_gv_name_setPerl_unshare_hekPerl_share_hekPerl_is_gv_magical_svPerl_magic_freeovrldPerl_gp_refPerl_gp_freePerl_sv_backoffPerl_newGPPerl_safesyscallocPerl_gv_initPerl_sv_reftypePerl_sv_add_backrefPerl_gv_fetchfile_flagsPerl_gv_const_svPerl_amagic_callPerl_gv_fetchmethod_autoloadPerl_save_scalarPerl_is_utf8_idcontPerl_is_utf8_digitstrcmpPerl_warnPerl_gv_stashpvnPerl_vnumifyPL_sig_namePerl_new_version__memcpy_chkPerl_gv_fetchmethPerl_mro_get_linear_isaPerl_mro_meta_initPerl_gv_autoload4Perl_gv_fetchmeth_autoloadPerl_gv_stashpvPerl_gv_fetchmethod_flagsPerl_Gv_AMupdatePerl_sv_unmagicPerl_gv_handlerPerl_lex_endPerl_lex_bufutf8Perl_keyword_plugin_standardPerl_pmflagPerl_scan_vstring__ctype_b_locPerl_lex_read_toPerl_scan_numPerl_grok_numberPerl_my_atofPerl_sv_setnvPerl_sv_setuvPerl_keywordPerl_is_utf8_alnumPerl_sv_pvn_force_flagsPerl_lex_grow_linestrPerl_str_to_versionPerl_is_ascii_stringPerl_is_utf8_stringPL_utf8skipPerl_is_utf8_markPerl_filter_readPerl_PerlIO_readPerl_PerlIO_errorPerl_utf16_to_utf8_reversedPerl_utf16_to_utf8Perl_diePerl_av_popPerl_lex_next_chunkPerl_PerlIO_clearerrPerl_lex_read_spacesetlocalePerl_utf8_to_uvchrPerl_sv_cat_decodePerl_sv_magicextPerl_lex_peek_unicharPerl_lex_read_unicharPerl_parser_freePerl_lex_discard_toPerl_lex_unstuffPerl_lex_stuff_pvnPerl_lex_stuff_svPerl_yylexPerl_utf8_lengthPerl_utf8_hopPL_no_myglobPerl_save_boolPerl_save_I8Perl_save_I16Perl_save_pptrPerl_save_generic_pvrefPerl_sv_utf8_upgrade_flags_growPerl_regcurlyPL_keyword_pluginPerl_PerlIO_tellPerl_delimcpyPerl_sv_recode_to_utf8__sprintf_chkPerl_sv_catsv_flagsPL_warn_nosemiPerl_rsignal_saveexecvPerl_rsignal_restorePL_warn_reservedPerlIO_apply_layersPerl_prescan_versionPerl_scan_version__snprintf_chkPerl_save_destructor_xPL_pad_reset_pendingPL_min_intro_pendingPL_max_intro_pendingPL_comppad_name_fillPerl_pad_pushPerl_av_extendPerl_do_dump_padPerl_dump_indentPL_padixPL_comppad_name_floorPL_padix_floorPerl_find_rundefsvoffsetPerl_find_runcvPerl_sv_eqPerl_cv_clonePerl_av_fillPerl_regdumpPerl_regpropPerl_re_intuit_stringPerl_regnextPL_regdummyPerl_reg_numbered_buff_storePL_localizingPL_no_modifyPerl_save_re_contextPerl_savestack_grow_cntPerl_pregfreePerl_pregfree2Perl_regfree_internalPerl_reg_temp_copyPerl_reg_qr_packagePerl_reg_numbered_buff_lengthPerl_is_utf8_string_loclenPerl_report_uninitPerl_reg_numbered_buff_fetchPerl_sv_untaintPerl_reg_named_buff_firstkeyPerl_hv_iterinitPerl_reg_named_buff_nextkeyPerl_hv_iternext_flagsPerl_reg_named_buff_iterPerl_reg_named_buff_allPerl_newRV_noincPerl_reg_named_buff_scalarPerl_reg_named_buff_existsPerl_reg_named_buff_fetchPerl_reg_named_buffPerl_vmessPerl_to_uni_foldmemsetPerl_sv_len_utf8PL_foldPL_regkindPerl_sv_compile_2opPL_fold_localePerl_reginitcolorsPL_colorsPL_colorsetPL_simplePL_variesPerl_ninstrPerl_repeatcpyPerl_re_compilePL_core_reg_enginePL_reg_namePL_reg_extflags_namePerl_regexec_flagsPerl_re_intuit_startPerl_debprofdumpPerl_watchPL_watchokPL_op_sequencePerl_sv_2uv_flagsPL_op_seqPerl_pv_escapePerl_pv_prettyPerl_pv_displayPerl_dump_vindentPerlIO_vprintfPerl_do_gvgv_dumpPerlIO_putcPerl_do_gv_dumpPerl_do_hv_dumpPerl_gv_dumpPerl_sv_peekPerl_sv_taintedPerl_set_numeric_localPerl_sv_uni_displayPerl_debopPerl_debPerl_runops_debugPerl_deb_stack_allPerl_despatch_signalsPerl_debstackPerl_do_op_dumpPerl_fetch_cop_labelPerl_do_pmop_dumpPerl_op_dumpPerl_pmop_dumpPerl_dump_evalPerl_dump_formPerl_dump_sub_perlPerl_dump_subPerl_dump_packsubs_perlPerl_dump_packsubsPerl_dump_all_perlPerl_PerlIO_setlinebufPerl_dump_allPerl_do_sv_dumpPerl_do_magic_dumpPerl_av_arylen_pPerl_hv_placeholders_getPerl_hv_backreferences_pPerl_hv_itervalPerl_hv_iterkeysvPerl_sv_dumpPL_vtbl_svPL_vtbl_envPL_vtbl_envelemPL_vtbl_sigPL_vtbl_sigelemPL_vtbl_packPL_vtbl_packelemPL_vtbl_dblinePL_vtbl_isaPL_vtbl_arylenPL_vtbl_mglobPL_vtbl_nkeysPL_vtbl_taintPL_vtbl_substrPL_vtbl_vecPL_vtbl_posPL_vtbl_bmPL_vtbl_fmPL_vtbl_uvarPL_vtbl_defelemPL_vtbl_collxfrmPL_vtbl_amagicPL_vtbl_amagicelemPL_vtbl_backrefPL_vtbl_utf8PL_vtbl_arylen_pPL_vtbl_hintselemPL_vtbl_hintsPerlIO_putsPerl_magic_dumpPerl_rninstrPerl_ibcmpPerl_ibcmp_localePerl_my_swabnPerl_atfork_lockPerl_atfork_unlockPerl_get_contextPerl_set_contextPerl_get_op_namesPerl_get_op_descsPerl_get_no_modifyPerl_get_opargsPerl_get_ppaddrPerl_get_vtblPL_vtbl_regdatumPL_vtbl_regdataPL_vtbl_regexpPL_vtbl_isaelemPerl_mini_mktimePerl_get_re_argPerl_mg_getPerl_my_dirfdPerl_get_db_subPerl_my_strlcpyPerl_my_strlcatPerl_getenv_lenPerl_seedgettimeofdayPerl_my_socketpairPerl_vverifyPerl_getcwd_svgetcwdPerl_init_tmPerl_PerlIO_flushPerl_wait4pidsigactionsigemptysetPerl_my_pclosePerl_my_forkPerl_mallocPerl_new_warnings_bitfieldPerl_reallocPerl_sv_2cvPerl_write_to_stderrPerl_PerlIO_writePL_no_memPerl_savesharedpvnPL_nomemokPerl_savesvpvPerl_screaminstrPerl_fbm_instrPL_freqPerl_mfreePerl_my_clearenvPerl_my_strftimeunsetenvPerl_callocPerl_sv_vsetpvfnPerl_vwarnPerl_vwarnerPerl_die_wherePerl_report_evil_fhPerl_sv_mortalcopyPerl_vcroakPerl_my_vsnprintf__vsnprintf_chkPerl_my_snprintfsrand48drand48strtoulPerl_vcmpPerl_vnormaldivPerl_newSVrvPerl_sv_insert_flagsPerl_sv_lenPerl_candoPerl_my_popendup2PL_forkprocessPerl_taint_envPerl_do_execfreePerl_do_exec3Perl_my_popen_listPerl_do_aexec5Perl_vformPerl_mg_magicalPerl_magic_regdata_cntPerl_magic_getuvarPerl_magic_setamagicPerl_magic_freearylen_pPerl_magic_gettaintPerl_magic_settaintPerl_magic_setmglobPerl_magic_setuvarPerl_magic_clearhintsPerl_magic_clearhintPerl_refcounted_he_newPerl_magic_sethintsigaddsetsigprocmaskPL_SvPL_XpvPL_sig_svPerl_whichsigPL_sig_numPerl_csighandlerPerl_magic_regdatum_setPerl_magic_setutf8Perl_magic_setcollxfrmPerl_magic_setregexpPerl_magic_killbackrefsPerl_sv_kill_backrefsPerl_magic_setdblinePerl_magic_setvecPerl_do_vecsetPerl_magic_getvecPerl_do_vecgetPerl_magic_getsubstrPerl_sv_pos_u2b_flagsPerl_magic_setsubstrPerl_magic_setposPerl_sv_pos_u2bPerl_magic_getposPerl_sv_pos_b2uPerl_magic_setarylenPerl_magic_wipepackPerl_magic_setpackPerl_magic_existspackPerl_magic_clearpackPerl_magic_getpackPerl_magic_nextpackPerl_magic_scalarpackPerl_hv_eiter_setPerl_magic_sizepackPerl_magic_setnkeysPerl_magic_getnkeysPerl_magic_clearisaPerl_mro_isa_changed_inPerl_magic_setisaPL_delaymagicPerl_magic_setsigPL_csighandlerpPerl_magic_clearsigPerl_magic_getsigPerl_magic_clear_all_envPerl_magic_set_all_envPerl_hv_iterkeyPerl_magic_clearenvPerl_magic_setenvPerl_emulate_cop_ioPerl_magic_getgetgroupsPerl_sv_copypvPerl_magic_lenPerl_magic_regdatum_getPerl_mg_copyPerl_mg_clearPerl_save_allocPerl_mg_sizePerl_vivify_defelemPL_no_helem_svPL_no_aelemPerl_magic_getdefelemPerl_magic_getarylenPerl_mg_lengthPerl_magic_setsetgroupssetegidseteuidsetreuidsetregidPerl_magic_setdefelemPerl_mg_localizePerl_reentrant_sizePerl_reentrant_initPerl_reentrant_freePerl_reentrant_retryPerl_mro_get_from_namePerl_mro_set_private_dataPerl_mro_get_private_dataPerl_mro_set_mroPerl_hv_clearPerl_newHVhvXS_mro_method_changed_inPerl_croak_xs_usagePerl_mro_registerPL_hv_fetch_ent_mhPL_body_rootsPerl_offer_nice_chunkPerl_bytes_from_utf8Perl_unsharepvnPerl_get_arenaPerl_hv_placeholders_setPerl_hv_placeholders_pPerl_hv_kill_backrefsPerl_hv_riter_setPerl_hv_eiter_pPerl_hv_riter_pPerl_hv_free_entPerl_refcounted_he_chain_2hvPerl_hv_clear_placeholdersPerl_hv_iternextsvPerl_hv_delayfree_entPerl_hv_scalarPerl_hv_undefPerl_av_reifyPerl_av_iter_pPerl_av_existsPerl_av_makePerl_av_undefPerl_av_deletePerl_pp_nullPerl_pp_pushrePerl_pp_gvPerl_pp_constPerl_pp_method_namedPerl_pp_methodPerl_pp_definedPerl_pp_aelemfastPerl_sub_crush_depthPerl_pp_eqPerl_pp_enterPerl_cxincPerl_block_gimmePerl_pp_entersubPL_no_usymPerl_pp_leavePerl_pp_leavesublvPerl_tmps_growPerl_pp_leavesubPerl_pp_nextstatePerl_pp_orPerl_pp_cond_exprPerl_pp_andPerl_pp_grepwhilePerl_pp_unstackPerl_pp_preincPerl_sv_incPerl_pp_iterPerl_do_readlinePerl_sv_unref_flags__lxstat64Perl_nextargvPerl_do_closePerl_start_globPerl_do_opennPerl_pp_matchPerl_dowantarrayPerl_pp_qrPerl_sv_blessPerl_pp_aassignsetresgidsetresuidPerl_pp_rv2avPerl_softref2xvPerl_is_lvalue_subPL_no_localize_refPerl_save_aryPerl_save_hashPerl_do_kvPerl_pp_printPerl_do_printPerl_save_generic_svrefPerl_pp_joinPerl_do_joinPerl_pp_addPerl_sv_2numPerl_pp_readlinePerl_pp_rv2gvPerl_pp_concatPerl_pp_sassignPerl_pp_stringifyPerl_pp_gvsvPerl_vivify_refPerl_pp_aelemPerl_save_aelem_flagsPerl_save_adeletePerl_pp_helemPerl_save_gpPerl_save_helem_flagsPerl_save_hdeletePerl_pp_padsvPerl_save_clearsvPerl_pp_substPerl_rxres_savePL_sv_arenarootPerl_sv_report_usedPerl_sv_newrefPerl_ptr_table_fetchPerl_ptr_table_clearPerl_ptr_table_freePL_body_arenasPL_nice_chunkPL_nice_chunk_sizePL_sv_rootPerl_ptr_table_splitPerl_ptr_table_newPerl_ptr_table_storePerl_sv_isobjectPerl_sv_isaPerl_sv_truePerl_sv_2ioPerl_sv_vcatpvfnPL_hexdigitfrexpPerl_sv_setuv_mggcvtPerl_sv_vcatpvf_mgPerl_sv_catpvf_mgPerl_sv_vcatpvfPL_warn_uninitPerl_io_closePL_last_swash_hvPerl_sv_rvweakenPerl_sv_collxfrmPerl_mem_collxfrmPerl_sv_cmp_localePL_vtbl_ovrldPerl_sv_replacePerl_sv_setref_nvPerl_newSVnvPerl_sv_setnv_mgPerl_sv_setref_ivPerl_sv_setref_uvPerl_sv_setiv_mgPerl_sv_catpv_mgPerl_sv_pvutf8n_forcePerl_sv_setpv_mgPerl_sv_setpvivPerl_sv_setpviv_mgPerl_sv_setref_pvnPerl_sv_setpvn_mgPerl_sv_setref_pvPerl_sv_setsv_mgPerl_sv_utf8_downgradePerl_utf8_to_bytesPerl_sv_pvbyten_forcePerl_sv_2pvbytePerl_looks_like_numberPerl_cast_uvPerl_cast_ivPerl_sv_decPerl_sv_vsetpvf_mgPerl_sv_setpvf_mgPerl_sv_vsetpvfPerl_vnewSVpvfPerl_sv_utf8_encodePerl_sv_2pvutf8PerlIO_isutf8PerlIO_getcPerl_PerlIO_eofPerlIO_fast_getsPerl_PerlIO_get_cntPerl_PerlIO_get_ptrPerl_PerlIO_set_ptrcntPerl_sv_resetPerl_pp_oncePerl_pp_boolkeysPerl_unimplemented_opPerl_pp_lockPerl_pp_srefgenPerl_pp_stubPerl_pp_splitPerl_save_pushptrptrPerl_is_utf8_spacePerl_pp_listPerl_pp_reversePerl_pp_unshiftPerl_pp_shiftPerl_pp_pushPerl_pp_lslicePerl_pp_refgenPerl_pp_splicePerl_pp_anonhashPerl_pp_hslicePerl_pp_existsPerl_pp_deletePerl_pp_aslicePerl_pp_eachPerl_pp_akeysPerl_pp_aeachPerl_pp_quotemetaPerl_pp_lcPerl_to_utf8_lower__ctype_tolower_locPL_latin1_lcPerl_pp_ucPerl_to_utf8_upper__ctype_toupper_locPL_mod_latin1_ucPerl_pp_ucfirstPerl_to_utf8_titlePerl_pp_cryptPerl_pp_chrPerl_uvchr_to_utf8_flagsPerl_pp_ordPerl_pp_sprintfPerl_do_sprintfPerl_pp_indexPerl_pp_posPerl_pp_vecPerl_pp_substrPerl_pp_lengthPerl_pp_octPerl_grok_binPerl_pp_i_negatePerl_pp_i_ncmpPerl_pp_i_nePerl_pp_i_eqPerl_pp_i_gePerl_pp_i_lePerl_pp_i_gtPerl_pp_i_ltPerl_pp_i_subtractPerl_pp_i_addPerl_pp_i_moduloPerl_pp_i_dividePerl_pp_i_multiplyPerl_pp_complementPerl_pp_nePerl_pp_gePerl_pp_lePerl_pp_gtPerl_pp_ltPerl_pp_right_shiftPerl_pp_left_shiftPerl_pp_absPerl_pp_subtractPerl_pp_dividePerl_pp_multiplyPerl_pp_intceilPerl_pp_srandPL_srand_calledPerl_pp_randPerl_pp_sinPerl_pp_atan2Perl_pp_notPerl_pp_negatePerl_pp_bit_orPerl_do_vopPerl_pp_bit_andPerl_pp_scmpPerl_pp_slePerl_pp_snePerl_pp_seqPerl_pp_ncmp__isnanPerl_pp_repeatPerl_pp_modulofmodPerl_pp_powPerl_pp_postdecPerl_pp_predecPerl_pp_postincPerl_pp_chompPerl_do_chompPerl_pp_schompPerl_pp_chopPerl_do_chopPerl_pp_schopPerl_pp_transPerl_do_transPerl_pp_studyPerl_pp_gelemPerl_pp_blessPerl_pp_refPerl_pp_anoncodePerl_pp_prototypePerl_pp_rv2cvPerl_pp_av2arylenPerl_pp_rv2svPerl_pp_padavPerl_pp_padhvPerl_pp_undef_LIB_VERSIONPerl_cx_dumpPerl_savestack_growPerl_save_deletePerl_save_destructorPerl_save_padsv_and_mortalizePerl_save_set_svflagsPerl_save_svrefPerl_save_aptrPerl_save_shared_pvrefPerl_pp_regcresetPerl_pp_leavewhenPerl_pp_leavegivenPerl_pp_xorPerl_pp_enterwhenPerl_pp_enterloopPerl_pp_rangePerl_pp_wantarrayPerl_pp_smartmatchPerl_pp_entergivenPerl_pp_leaveloopPerl_pp_leavetryPerl_pp_entertryPerl_pp_leaveevalPerl_pp_enterevalPerl_pp_hintsevalPerl_pp_requirestrstrPerl_pp_mapwhilePerl_pp_exitPL_lastgotoprobePerl_pp_enteriterPerl_pp_dbstatePerl_pp_resetPerl_pp_callerPerl_pp_breakPerl_pp_continuePerl_pp_gotoPerl_pp_redoPerl_pp_nextPerl_pp_lastPerl_pp_returnPerl_pp_flopPerl_pp_flipPerl_pp_grepstartPerl_pp_formlinePerl_pp_regcompPerl_pp_substcontPerl_pp_syscallPerl_pp_getloginPerl_pp_egrentendgrentPerl_pp_sgrentsetgrentPerl_pp_ggrentgetgrentgetgrgidgetgrnamPerl_pp_epwentendpwentPerl_pp_spwentsetpwentPerl_pp_gpwentgetspnamgetpwnamgetpwentgetpwuidPerl_pp_eserventendserventPerl_pp_eprotoentendprotoentPerl_pp_enetentendnetentPerl_pp_ehostentendhostentPerl_pp_sserventsetserventPerl_pp_sprotoentsetprotoentPerl_pp_snetentsetnetentPerl_pp_shostentsethostentPerl_pp_gserventgetserventgetservbyportgetservbynamePerl_pp_gprotoentgetprotoentgetprotobynumbergetprotobynamePerl_pp_gnetentgetnetentgetnetbyaddr__h_errno_locationgetnetbynamePerl_pp_ghostentgethostentgethostbyaddrgethostbynamePerl_pp_semctlPerl_do_ipcctlPerl_pp_semgetPerl_do_ipcgetPerl_pp_shmwritePerl_do_shmioPerl_do_msgsndPerl_do_semopPerl_do_msgrcvPerl_pp_timePerl_pp_sleeppausePerl_pp_alarmPerl_pp_gmtimePerl_pp_tmsPL_timesbufPerl_pp_setpriorityPerl_pp_getpriorityPerl_pp_setpgrpsetpgidPerl_pp_getpgrpgetpgidPerl_pp_getppidPerl_pp_execPerl_pp_systemPerl_pp_waitpidPerl_pp_waitPerl_pp_forkPerl_pp_closedirPerl_pp_rewinddirPerl_pp_seekdirPerl_pp_telldirPerl_pp_readdirreaddir64Perl_pp_open_diropendirPerl_pp_rmdirPerl_pp_mkdirPerl_pp_readlinkPerl_pp_linkPerl_pp_renamePerl_pp_chrootPerl_pp_chownPerl_applyPerl_pp_chdirfchdirPerl_pp_fttextPL_statcachePerlIO_has_basePerl_PerlIO_get_bufsizPerl_PerlIO_get_basePL_warn_nlPerl_pp_ftttyisattyPerl_pp_ftlinkPerl_my_lstatPerl_pp_ftrownedPerl_my_statPerl_pp_ftisPerl_pp_ftrreadeaccessPerl_pp_statPerl_pp_getpeernamePerl_pp_ssockoptgetsockoptsetsockoptPerl_pp_shutdownPerl_pp_acceptPerl_pp_pipe_opPerl_pp_listenPerl_pp_connectPerl_pp_bindPerl_pp_sockpairPerl_pp_socketPerl_pp_flockPerl_pp_ioctlPerl_pp_truncateftruncate64Perl_pp_tiedPerl_pp_filenoPerl_pp_closePerl_pp_sysseekPerl_do_sysseekPerl_do_seekPerl_pp_tellPerl_do_tellPerl_pp_sysopenPerl_pp_openPerl_pp_eofPerl_do_eofPerl_pp_sendsendtoPerl_pp_sysreadrecvfromPerl_pp_prtfPerl_pp_leavewritePerl_pp_enterwritePerl_pp_getcPerl_pp_selectPerl_pp_sselectPerl_pp_dbmopenPerl_pp_untiePerl_pp_tiePerl_pp_binmodePerl_pp_umaskPerl_pp_diePerl_pp_warnPerl_pp_rcatlinePerl_pp_globPL_no_securityPerl_pp_backtickPerl_PerlIO_context_layersPerl_swash_fetchshmatshmdtPL_ArgvPL_CmdexecvpPL_sh_pathexecllseek64Perl_PerlIO_seekkillpgfutimesfchownfchmodPerlIO_intmode2strPerlIO_opennPerlIO_fdupopenPL_filemodePL_lastfdPL_oldnamePerlIO_has_cntptrPerlIO_canset_cntPerl_PerlIO_set_cntPerl_regclass_swashPerl_to_utf8_foldPerl_is_uni_alnum_lcPerl_is_uni_space_lcPL_regmatch_statePerl_is_uni_alnumPerl_ibcmp_utf8PL_utf8_X_beginPL_utf8_X_non_hangulPL_utf8_X_extendPL_utf8_X_prependPL_utf8_X_LPL_utf8_X_LVPL_utf8_X_LVTPL_utf8_X_LV_LVT_VPL_utf8_X_TPL_utf8_X_VPerl_is_uni_digit_lcPerl_is_utf8_X_VPerl_is_utf8_X_LVPerl_is_utf8_X_LPerl_is_utf8_X_prependPerl_is_utf8_X_extendPerl_is_utf8_X_LV_LVT_VPerl_is_utf8_X_LVTPerl_is_utf8_X_TPerl_is_utf8_X_non_hangulPerl_is_utf8_X_beginPerl_utf8_distancePerl_pregexecPerl_is_utf8_charPerl_utf8n_to_uvchrPL_last_swash_klenPL_last_swash_tmpsPL_last_swash_slenPL_last_swash_keyPerl_is_utf8_xdigitPerl_is_utf8_punctPerl_is_utf8_printPerl_is_utf8_graphPerl_is_utf8_cntrlPerl_is_utf8_lowerPerl_is_utf8_upperPerl_is_utf8_posix_digitPL_utf8_posix_digitPerl_is_utf8_perl_wordPL_utf8_perl_wordPerl_is_utf8_perl_spacePL_utf8_perl_spacePerl_is_utf8_asciiPerl_is_utf8_alphaPerl_is_utf8_idfirstPerl_utf8_to_uvuniPerl_pv_uni_displayPerl_uvchr_to_utf8Perl_to_utf8_casePerl_to_uni_lowerPerl_to_uni_lower_lcPerl_to_uni_titlePerl_to_uni_title_lcPerl_to_uni_upperPerl_to_uni_upper_lcPerl_is_uni_xdigitPerl_is_uni_xdigit_lcPerl_is_uni_punctPerl_is_uni_punct_lcPerl_is_uni_printPerl_is_uni_print_lcPerl_is_uni_graphPerl_is_uni_graph_lcPerl_is_uni_cntrlPerl_is_uni_cntrl_lcPerl_is_uni_lowerPerl_is_uni_lower_lcPerl_is_uni_upperPerl_is_uni_upper_lcPerl_is_uni_digitPerl_is_uni_spacePerl_is_uni_asciiPerl_is_uni_ascii_lcPerl_is_uni_alphaPerl_is_uni_alpha_lcPerl_is_uni_idfirstPerl_is_uni_idfirst_lcPerl_vdebPerl_debstackptrsXS_Internals_HvREHASHXS_Tie_Hash_NamedCapture_flagsXS_Tie_Hash_NamedCapture_SCALARXS_Tie_Hash_NamedCapture_NEXTKXS_Tie_Hash_NamedCapture_FIRSTKXS_Tie_Hash_NamedCapture_EXISTSXS_Tie_Hash_NamedCapture_FETCHXS_re_regnames_countXS_Tie_Hash_NamedCapture_CLEARXS_Tie_Hash_NamedCapture_DELETEXS_Tie_Hash_NamedCapture_STOREXS_re_is_regexpXS_re_regexp_patternXS_re_regnameXS_Internals_SvREADONLYXS_re_regnamesXS_Internals_rehash_seedXS_Internals_hash_seedXS_PerlIO_get_layersXS_Internals_hv_clear_placeholdXS_Internals_SvREFCNTXS_utf8_unicode_to_nativeXS_utf8_native_to_unicodeXS_utf8_downgradeXS_utf8_upgradeXS_utf8_decodeXS_utf8_encodeXS_utf8_validXS_utf8_is_utf8XS_version_qvXS_version_newXS_UNIVERSAL_canXS_UNIVERSAL_isaXS_UNIVERSAL_DOESXS_UNIVERSAL_VERSIONXS_version_noopXS_version_stringifyXS_version_numifyXS_version_normalXS_version_vcmpXS_version_booleanXS_version_is_alphaXS_version_is_qvPerl_sv_doesPL_no_wrongrefPL_no_symrefPL_no_symref_svPL_no_sock_funcPL_no_dir_funcPL_no_funcPL_uuemapPL_uudmapPL_bitcountPerl_pp_unpackPerl_pp_packPerl_pp_sortPL_patleavePL_perlio_fd_refcntPL_perlio_fd_refcnt_sizePL_perlio_debug_fdPL_runops_stdPL_runops_dbgPL_revisionPL_versionPL_subversionPL_naPL_sortcopPL_sortstashPL_firstgvPL_secondgvPL_collxfrm_basePL_ptr_tablePL_sort_RealCmpPL_reentrant_retintperlsio_binmodePerlIO_clonePerlIO_arg_fetchPerlIOUtf8_pushedPerlIO_modestrPerlIOBase_poppedPerlIOBase_noop_okPerlIOBase_noop_failPerlIOBase_eofPerlIOBase_errorPerlIOBase_setlinebufPerlIOUnix_filenoPerlIOStdio_modePerlIOStdio_get_basePerlIOStdio_get_bufsizPerlIOStdio_get_ptrPerlIOStdio_get_cntPerlIOStdio_set_ptrcntPerlIO_getnamePerlIO_vsprintfPerlIO_sprintfPerlIOUnix_oflagsPerlIOBase_pushedPerlIOPending_pushedPerlIOCrlf_set_ptrcntPerlIOBuf_set_ptrcntPerlIOBuf_bufsizPerlIOBuf_get_cntPerlIOBuf_get_ptrPerlIOBase_clearerrPerl_PerlIO_fillPerlIOCrlf_get_cntPerlIO_getposPerlIO_rewindPerlIO_setposPerlIOBase_filenoPerlIOMmap_unmapmunmapPerlIOMmap_mapmmap64abortPerlIOBuf_poppedPerlIO_list_freePerlIOBuf_get_basePerlIOMmap_get_basePerlIO_list_allocPerlIO_allocatePerlIOBase_readPerlIOBuf_readPerlIOPending_readPerlIOBuf_pushedPerlIOStdio_filenoPerlIOStdio_flushfflushPerlIOStdio_errorferrorPerlIOStdio_setlinebufPerlIOStdio_clearerrPerlIOStdio_eoffeofPerlIOStdio_tellftello64PerlIOStdio_seekfseeko64PerlIOStdio_writefwritePerlIOStdio_readfreadfgetcPerlIOUnix_tellPerlIOUnix_seekPerlIOUnix_writePerlIOUnix_readPerlIO_sv_dupXS_PerlIO__Layer__findXS_PerlIO__Layer__NoWarningsPerlIO_tab_svPerlIO_list_pushPerlIO_clone_listPerlIO_debugPerlIOUnix_refcnt_decPerlIOUnix_closePerlIOPending_set_ptrcntPerlIOPending_seekPerlIOPending_fillPerlIOBuf_tellPerlIOBuf_seekPerlIOBuf_writePerlIOMmap_writePerlIOCrlf_writePerlIOBuf_flushPerlIOMmap_flushPerlIOCrlf_flushPerlIOStdio_closefclosePerlIOBase_closePerlIOBuf_closePerlIO__closePerlIOMmap_closePerlIOBase_flush_linebufPerlIOBuf_fillPerlIOMmap_fillPerlIO_layer_fetchPerlIO_define_layerPerlIO_find_layerPerlIO_parse_layersPerlIO_default_bufferPerlIO_stdioPerlIO_perlioPerlIO_default_layersPerlIO_unixPerlIO_rawPerlIO_crlfPerlIO_mmapPerlIO_utf8PerlIO_removePerlIO_bytePerlIO_default_layerPerlIORaw_openPerlIO_popPerlIOCrlf_binmodePerlIOCrlf_pushedPerlIOPending_flushPerlIO_releaseFILEPerlIOStdio_pushedPerlIOPending_closePerlIO_cleantablePerlIOBase_binmodePerlIOPop_pushedPerlIORaw_pushedPerlIO_pushPerlIOBuf_openPerlIOBase_unreadPerlIO_pendingPerlIOBuf_unreadPerlIOMmap_unreadPerlIOCrlf_unreadPerlIOStdio_unreadPerlIOStdio_fillPerl_PerlIO_unreadPerlIO_apply_layeraPerlIOBase_dupPerlIOMmap_dupPerlIOBuf_dupPerlIO_resolve_layersPerlIO_tmpfilePerlIO_reopenmkstemp64PerlIO_stdstreamsPerlIO_stdoutfPerlIOUnix_refcnt_incPerlIO_exportFILEPerlIO_findFILEPerlIOStdio_dupPerlIOStdio_openfopen64freopen64PerlIO_importFILEPerlIOUnix_dupPerlIOUnix_openPerlIOUnix_pushedPerl_cast_ulongPerl_cast_i32Perl_grok_numeric_radixPerl_my_atof2strtodPerl_scan_octPerl_scan_binPerl_scan_hexPerl_hugePerl_pp_scalarPerl_pp_regcmaybePerl_pp_lineseqPerl_pp_scopePerl_sv_nolockingPerl_newIOPerl_newHVPerl_newAVPerl_gv_IOaddPerl_gv_HVaddPerl_gv_AVaddPerl_gv_SVaddPerl_save_opPerl_save_freepvPerl_save_freeopPerl_save_mortalizesvPerl_save_freesvPerl_sv_insertPerl_hv_deletePerl_hv_fetchPerl_hv_existsPerl_hv_storePerl_hv_store_flagsPerl_hv_delete_entPerl_hv_fetch_entPerl_hv_exists_entPerl_hv_store_entPerl_pack_catPerl_packlistPerl_unpack_strPerl_unpackstringPerl_sv_usepvnPerl_sv_usepvn_mgPerl_sv_setsvPerl_save_listPerl_save_nogvPerl_save_ivPerl_save_longPerl_is_utf8_string_locPerl_uvuni_to_utf8Perl_pp_rv2hvPerl_pp_bit_xorPerl_pp_sqrtPerl_pp_logPerl_pp_expPerl_pp_cosPerl_pp_popPerl_pp_hexPerl_pp_rindexPerl_pp_sgePerl_pp_sgtPerl_pp_sltPerl_pp_lcfirstPerl_pp_dorassignPerl_pp_dorPerl_pp_orassignPerl_pp_andassignPerl_pp_semopPerl_pp_msgrcvPerl_pp_msgsndPerl_pp_shmreadPerl_pp_syswritePerl_pp_fteexecPerl_pp_ftewritePerl_pp_ftereadPerl_pp_ftrexecPerl_pp_ftrwritePerl_pp_symlinkPerl_pp_killPerl_pp_utimePerl_pp_chmodPerl_pp_unlinkPerl_pp_ftsvtxPerl_pp_ftsgidPerl_pp_ftsuidPerl_pp_ftpipePerl_pp_ftdirPerl_pp_ftfilePerl_pp_ftblkPerl_pp_ftchrPerl_pp_ftsockPerl_pp_ftzeroPerl_pp_fteownedPerl_pp_ftctimePerl_pp_ftatimePerl_pp_ftmtimePerl_pp_ftsizePerl_pp_ggrgidPerl_pp_ggrnamPerl_pp_gpwuidPerl_pp_gpwnamPerl_pp_gsbyportPerl_pp_gsbynamePerl_pp_gpbynumberPerl_pp_gpbynamePerl_pp_gnbyaddrPerl_pp_gnbynamePerl_pp_ghbyaddrPerl_pp_ghbynamePerl_pp_msgctlPerl_pp_shmctlPerl_pp_msggetPerl_pp_shmgetPerl_pp_localtimePerl_pp_ftbinaryPerl_pp_lstatPerl_pp_getsocknamePerl_pp_gsockoptPerl_pp_fcntlPerl_pp_seekPerl_pp_recvPerl_pp_readPerl_pp_dbmclosePerl_pp_dofilePerl_pp_dumpPerl_pp_keysPerl_pp_valuesPerl_pp_mapstartPerl_pp_padanyPerl_init_i18nl14nPerl_do_execPerl_do_aexecPerl_do_binmodePerl_do_open9Perl_do_openPerl_hv_magicPerl_sv_taintPerl_hv_iternextPerl_gv_fetchmethodPerl_gv_efullname3Perl_gv_efullnamePerl_gv_fullname3Perl_gv_fullnamePerl_printf_nocontextPerl_fprintf_nocontextPerl_sv_utf8_upgradePerl_sv_pvutf8Perl_sv_pvPerl_sv_pvn_nomgPerl_sv_pvnPerl_sv_pvutf8nPerl_sv_2pv_nolenPerl_sv_2pvPerl_sv_pvbytenPerl_sv_pvbytePerl_sv_pvn_forcePerl_sv_nvPerl_sv_uvPerl_sv_2uvPerl_sv_ivPerl_sv_2ivPerl_sv_catsv_mgPerl_sv_catsvPerl_sv_catpvn_mgPerl_sv_catpvnPerl_sv_force_normalPerl_sv_2pvutf8_nolenPerl_sv_2pvbyte_nolenPerl_sv_unrefPerl_refstrxfrmPerl_new_collatePerl_new_ctypePerl_set_numeric_radixlocaleconvPerl_new_numericnl_langinfomodfPerl_sortsv_flagsPerl_sortsvboot_DynaLoaderXS_DynaLoader_dl_load_fileXS_DynaLoader_dl_unload_fileXS_DynaLoader_dl_find_symbolXS_DynaLoader_dl_undef_symbolsXS_DynaLoader_dl_install_xsubXS_DynaLoader_dl_errordlsymdlerrordlclosedlopenlibdl.so.2libm.so.6libcrypt.so.1libc.so.6__environ__stack_chk_fail_edata__bss_startlibperl.so.5.12GLIBC_2.0GLIBC_2.1GLIBC_2.1.3GLIBC_2.4GLIBC_2.3GLIBC_2.3.4GLIBC_2.11GLIBC_2.2          ii k0ii uii k  ii k#si ii ii ti ii uii ii k333333333333333333333333444 44$4(4,4044484<4@4D4H4L4P4`4d4h4l4p4t4x4|444444444444444444444444444444444555 55555 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|55555555555555555555555555555666 66666 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|666666666666666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|7777777777777777777777777777888 88888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|8888888888888888888889 999$9,949<9D9L9T9\9d9l9t9|999999999999999::: ::::: :$:(:,:0:4:8:<:@:D:`::::::::::::::::::::::::::::;;; ;;;;; ;$;(;,;0;4;8;<;@;D;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<< << <$<(<,<0<4<8<<<@<D<H<L<P<T<X<\<`<d<h<l<p<t<x<|<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<=== ===== =$=(=,=0=4=8=<=@=D=H=L=P=T=X=\=`=d=h=l=p=t=x=|=================================>>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>h>l>p>t>x>|>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ????? ?$?(?,?0?4?8?NNvNNNNiNAN`N%N[NN$NMNN NNNNNmN#N:NNUNN[NCNOaOOq OOO,O$OP O$O(O|,O0O4O8OhT lT?pT@tT xTA|T(ThT(TTTBTTCTTFTTTTXTDTxTpTETTTDT'TeTTTTTFTGTTT;THUUU UUUUIU U$UJ(U,U0U4U8UXYcYYT YYYKYY~ YX$Y(Y_,Y>0Y4Y8YpZtZxZ|ZZ+ZcZxZZ ZZuZZdZZZiZ=ZuZZZZSZvZZZZZxZZZZZZZLZ[<[[ [[[[[b [G$[$([,[0[4[P8[<[f@[D[}H[L[SP[T[)X[ \[`[d[h[&l[p[t[x[|[[[[+[[[[|[g[[[6[[[[[:[A[[[C[[[[3[[[[[Y[[[r\\\ \T\\\\x \$\ (\,\0\4\8\<\K@\~D\H\lL\P\]T\X\\\`\d\Th\Gl\p\At\x\Q|\\h\>\\\\\\\J\\\\\\\\/\\\\S\}\\\\\\\\\N\]]+]b ]]]^]] ]$](],]*0]4]8]<]@] D]H]oL]lP]T]X]R\]`]?d]h]ml]@p]t]`x]|]w]]]]l]]]]]]]]*]]B](]]]<]b]]]]~]v]]U]]]S] ]]^^^ ^;^^F^^n ^}$^(^A,^0^4^8^<^@^D^H^L^P^T^X^7\^`^%d^nh^l^p^ t^x^x|^+^)^^^^^ ^^^B^K^^ ^,^^^^i^^^6^^8^^&^^^^^^^H^X_i__> _____ _$_X(_,_w0_4__8_o<_@_D_H_L_iP_T_X_\_`_d_)h_l_p_t_x_|_{__J_L_~__@___N_U___(__f___UE?? hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhh h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h h h h h h h( $h0 (h8 p,h@ `0hH P4hP @8hX 0<h` @hh Dhp Hhx Lh Ph Th Xh \h `h dh hh plh `ph Pth @xh 0|h h h h h h h h h h( h0 h8 ph@ `hH PhP @hX 0h` hh hp hx h h h h h h h h ph `h Ph @h 0h h h h hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h h h h h h h h h  h($ h0( h8p, h@`0 hHP4 hP@8 hX0< h` @ hhD hpH hxL hP hT hX h\ h` hd hh hpl h`p hPt h@x h0| h h h h h h h h h  h( h0 h8p h@` hHP hP@ hX0 h` hh hp hx h h h h h h h hp h` hP h@ h0 h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh  h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhUS[HtX[ÐUVSl&u]xt$p&)9s p&p&9rƃl&[^]US.Ûtt $Ѓ[]Ë$ÐU]Ít&'U]Ít&'UWVt lj^_]ÍvwtAt?FtftvFu>?^_]Ít&ݍ&?뫉븍vUEtH]UU E9r v]ø]fÍ&9Pfr]ÍUPtuU@tF@ܐw5@t/Pt&Jt.t&t"@9tv1]Ít&t1&Ru@tU$yt$F%=tv~d=tmt&=t&f=t&t>=uYFv1t(F@xQF|^$t$]Ã`tTv1$t$]==}=t1t&Ӎt&tVtvu1FtFqt&=]=uvfF;x9;t$$]Ðt&-10vb1t&*1v'UEu1]fP w@=t@ ]Í&UEHQffBt]ÍAuQB vuH@]Ð&UE]Ð&UEPJ]Í&'U҉u}u1u}]Ít&rff~Ef t}u΋:9uȀzx‹tf@utHffuEt@f%ffEf}~t f} nMyaWf@KE>@f%f%*AAf@@Hff;xf}~tCB U;B EM ɉMAf%fE}B}PffjMQR;PX뛍UVSMú E@$g$_D$D$D$D$D$ D$D$$At5@@ t @ [^]fD$D$$` [^]Ð8 [^]Í'UVS} E@$$D$D$D$D$D$ D$D$$qt5@@ t @ [^]fD$D$$ [^]Ð [^]Í'U(]uƉ}wD$ D$t$lj$)G tG ]u}]ÍvD$"D$<$֍&'U8U ]E#Ðuu҉}}tED$$EtD$$tD$<$tD$4$a$US @D$f$$[]Ít&'UVS[D$$PfʍfP4@@pPVN0PVFff uN[^]ÍUVS0M 2Af%f=mtB8D$ET$ t$D$f$$0[^]ÍU $U뺐&U]IöuƉT$a$m$]u]ÐU] vuƉT$b$-$e]u]ÐU]u@-f%f=mt98D$ g$$ ]u]Í&4$ɍU(]YuƉ}tX@ftfV%=tv=t/u2~t-=t&=t=ft  tp]u}]ÍVtvFV%=uF@ENjF@@5u)1tTg$1떐F느t&tw U(uu]}@íFf%f :tabD$D$$诼t4D$D$$@%@=@tN~ Ff%fv]u}]Ít&N@fU8]Eu}4@@PuhPff[EudpN~fFf wdFu^f]|t }Ƀ8&|gEL$T$$!蒵E]u}]ff]tf\ut&늍OfFf wGuf]|u딍t&'UWVS B:A1B:A$ED$$/t& ֍ebUT$$UB @t&֍btbD$$-ED$$f֍ibctobD$$-詯ML$$I&U(]V}u 11Mx q tP)Ѓ~) 4]u}]D$T$$lfƍt&'UWVS,u6ãU iFff81f%f96ff=vff=f=ff=ft&f u|ftv@=D$F D$U$UA tG&6t,Ff%8968f=d,[^_]Í뼍t&Futߋ I0I ItЋ~ A u&Nqt F1v똍@0@ @tV @ txh$pHUt&'U(MU]u}AJ÷ 8uEtU9P&$#u]u}]Ð} .M D$ D$L$lj$xbD$D$4$Ntb|$D$4$蔷E@ bD$ D$D$4$bD$ D$D$4$MUbMD$4$T$ L$ Ht$D$$#y 9҉ыuD$ScD$4$ʶ`t&bD$D$4$F bD$ D$D$4$aU8]iu}hEE$x4d G(D$+$w(t.t*t%$UUt$T$$Ɖw(E]u}]Í'UH]uƉ}x y~@(twxtnD$:$tZPU܋H EMTt&t<׃9uUM܋E}<҉}} MH t#v(90t]u}]ÐPE؉$ZE@ƍUWV@tBpt;N wtvu^_] U8uu]s}tFtu4$S]u}]ÍFf%fEF@t&f=f}f}Ht&Tt4$FtVtfz$}uEf-fvqf}u F f-fv]4$ FFFCf=sf-ftF F c]}u]pFtPtR҉PtXF(Ftt t$ F,$E4$mF[t&$ 뮍$랍UWVSu3@=ufP$t_~ S\D$!$[@$$ @$@ Uf@(4$~u1P4t*@<uBB@4P<t.H tAtyAtPQMD$ D$UD$$=UD$T$@ $聽M> $]u}] U8]M6ãu}yM䋓$UIJt$<$D$蔹U|$D$$4ǂ@3M $J]u}]Ðt&U(]uu}} D$,$$fPf fPPPP4tH @tH (t<2u$]u}]É$腾8D$8h$ fU8uu]}V%#==Ft&Rf=Gt&=It&fFt&9 t&ffQf\F11ɅtP҉PFtzGP҉Whu\<$GRt&~k YFF$tP҉PFF t$dF ]u}]Ãt߃fFtP҉P0F뜍&&@fFcFuF$蟯륐t&!OF$$#$蠜v$v$耜Sv=t&v t&F$t&P҉Pq$葺dM$聺M<$xv$`v~PvFǐPPFt&$蘛vM$腛MtE<$EUuu]#ÐfFt*4$nFf%fFV F]u]Ív'UWVS|u3tFt|[^_]Í&SdD$$[$$ͶN1҉EȋEčt&N7N%=!vnvt) F -f5{fvhH[dt&= t&B&`&$FFVJff~NɉMttMIffubMЋIɉMtUMfAuJMԁy u>MԋIIffu)MԋIMIffuȀFJEЀH&=c==t&-wFf@uvBBf@t$趱et&=t&=t& $2)NEMԀNUBf%f=f ˆUu UЅ MAf%f= Vt@t*Px}xt܃`tnA} EЅUBf%f=t f xPEЉUUB9ua=vt&2=t&"fcvFEԋHMЋFf@u&BBf@t$t"PffC Hc|[^_]Ív=,U=l=t&zfFf@uvBBf@t$vB f@uB B f@t$NB$f@t&B$B$f@t$t&VBf%fJAturr @ẺEA EЋE؉EԋEA EED$D$EЉ$UMmMUEԋA A MԉJ~CNAf%f=.IAf%f D$A D$$UϵUA%@=@/cD$D$D$ D$D$ D$D$@$UMUMEEЋ@ xoBE@ ( @EERUR UԋEU؉E̋EB EED$D$D$ D$EԉD$UЋ@ @$MѼM@@  @ R t A  A D$ht$ Mԉ$L$F(ufB(B(f@t$莬=t&t+ t&EF:C fff !Pff~f9F ft&=v=t& =t&~F@@f%f=VBf%f=sRBf%f tf=VJAf%f AD$A D$Uȋ$A%@=@/cD$D$D$ D$D$ D$D$@$MMEUЋ@ xF@@PEu։ẺM fvv Ff%fuF@ 6 @EVJ MԉB D$D$ED$ D$MԉL$UЋ@ @$uM@@ h @ R tT A D$D$ $!t&FEt@f%frEPfuɉMQffESfhU҉UXJffDMQ6fB*z  R҉UfBz ыR9IɉMIffM;Q}uMIff_vT;LMԋAtHff~MԋMMAMAE}EEЉMԉ $UUU$JEHM̀IUfFPffNDHfAʉMLM@AN$E这EPffo$E蜙E$E芙E$t&Pffc$P!Rff ff$@JBhD$$M%hD$$$MHt&=8Lt&f fYt&JF@tF@aP V @ N$=UUЋ ɉM Qff҉URflP`$BFVffVRVWEԃ}ȉDE@f%fEЉf}(Uԋ9MԋBf%f"BUԋB@ @EЋ$1A U)U}MAtFf%f_Uԋ$זMԉ $̖Uԋ@ FFMԋNVUЈVffȀFffNv$1vJʉMM]gMԍvyI+URffBUB@FN@f%fFUċBlF$Е $UިU+EԉUUB$#uCQfVE $D$"D$UMMUEЋEEnVz B @x U~D$ D$U$T$E,E$#D$XhD$~ $U{U8UЉRffQQJffs9rjNMЉ $EU\EU $EGE8&$E-E|D$$E,cT$D$D$D$ D$A,$UcU@ T$$D$D$D$ D$@,$@aFP zD$ $END$"Ủ$T$uEԋEVu$D$D$D$ T$D$@,$脷D$$贸D$"D$ $1x&#xMy @I@${1oED$"D$Ẻ$UMUMEԋRUUU'U8uu]}Ff%KffVЃ<t Nf%f=f=DFt$Dȃ%=iV$tI@uDVu8ffmU8Jt&L$D$D$D$ D$B,U܉$1D$$aUBHfu@H L$@%D$j$D$$fthtZ9tV JfMEB f%fB@DBBȀB@HfuH f뮋HI It@<V+D$F D$$2D$D$$訧c$%P T$@%D$i$t&'UWVS}覨Gp@<tNt&4$D$谟vu[^_]ËVBf%f=uBtBHvtfFuF%=u&U8] vu}}D$$sf@f% fF6FEFE F$u0u>(t<8uA4$]u}]ÉU4$譡UtD$<$eF 뭉4$8D$8h$mt&U8]Æu}}D$$rf@f% fF6FEFE F$u0u>(t<8uA4$]u}]ÉU4$轠UtD$<$uF 뭉4$8D$8h$}t&USE(Õ@D$E D$E${[]Ít&'U8uu]}M~Gf%ft]u}]ÍvGEP D$:$Uqu΋ED$'$quUB% = tM@D$D$E$xEUD$$T${4$EʇEZGɐUWVS y,@%EEU$)U$tH !U$ t4U$ET(t u|EE;R"fE#EEE9(E@f%fftf=tftftt&,[^_]Í&twt&E^$PBff% fQEUAB`4Yt&E@@3EEEE9fE䋅dU$~dUPUPUP UPUPUPUċPUȋP ŰP$UЋP(@,UԍUE؋$|`D$$`ƉEEdjt$$җf $›t&ED$$uB & M܋Q M܋9 D$$聃`$d;3$>EED$$D$GvfQBf%fB@E@ 2E܅tE܃@E܁`pB 8G GtdGpx |D$$@ED$$D$q<$b謒t&蔟t&/|D$D$<$Gu7%_DGqP [<$譀'<$G뼉$D$KD$|D$B $j'U8uu]裞}Ft VffFt$DuzF~vt$fJt&~<$rtW<$Mku拓d$]u}]Ð|0Fxtލ<$qtɉ<$qu븁f2t&=t VBf%f=$Nq84$>qt =Kd0$U蚃Udb{8F~f%~fFfFFF@D$D$$-rF<$~skvfrt&~u#v-v<$t&ciGu<$o㍶<$ovF$oћv'UHuu]}耛FfftaFF@xt2WBf%Gff fFf%f=]u}]f4R Rt~'D$D$D$ D$D$ D$D$$t"@ @tN tN@FffF@u&Vf%f=z1f<$`n"vFxD$ D$D$$lHD$ D$D$$lHWBf%f=\BHRC0HQffIQffQ M䋋};9RJRabyxOffOffO} ;9Iҍyyaj[f?tNPffRu NPffSuNVBHJ${ЉU薘UJfftK1ftj0$EVEffteN<$fv봍D$$@`vFf%f=tBz<$둉$U5fU܋BQ}ωE#OfftfuG$t,Nj9u؉}B 1Ҁy*E}ybt&Zt&U(]Æ}ljut@tptv4$kvu]u}]fU8]ɖ6u}}D$$gbf@f% fFf6FE FE F$u0u>(t<8uA4$]u}]ÉU4$eUtD$<$F 뭉4$x8D$8h$%'UWVSǕ4@f%f=u\wtt&Ft4$cvufd$G4GtG[^_]Ívf=tf=Jtf=učD$$yU8] vu}}4EE h9:6dEQ tEmxE]u}]Ðt&E<$bEUS莔D$$By[]Ít&UWVS\ɯ,UME }ED$$U؉M_U؋M܅҉f%fEf}Ff%f EfFVFEɈFthEFJ(t<8uu4$t ,[^_]Ðt&HU9uPRP,[^_]aEFfD$$$xM܉/4$u8D$8h$g UWVS yʁNVtK(t <84$<[^_]Ít&}uZ}tdQNVuU܉MD$$vMHU܀NFuF낃M X&uYt&1M4$it8D$8h$US$蛑tPfft D$ D$D$$Y$E_E$[]ÍUuu]3àF@u4$]]u]ÐN@_F]u]UVSZE5$dƋE #$dt$ $D$ED$v[^]É'UU ]M胐Eut.p9t&D$ T$D$ $X]u]Ít&t8@t"HJPPP]u]Ðt&PHՍ&HIJHQBuPP뺍&농t&UWVS輏)LfD$0$EX[Ƌ~$MFf% fFFM4Nd?~ y }܉6~$x(t~(@,F,t@ M t:M F,U؉L$$h4F,E D$$wU؋Nǀ@t@MFFt }y4$\Et$$D$vL[^_]fU؃E$ w|$E $D$kU؉Njv$x9M;9]NfɶfNNX;+@@ @VD$$T$q;Jp&$}t&HN~vEfQ'U(U ]EPu҉}t5t/r;uuI}t(rtRJABЋ]u}]frtЍ&D$ ET$D$$T뼍vJB맍vUWVSP5âfftop1u ZfvtQFf%fuF@D$F$D$a|$$D$uvu&[^_]ËPBT$@$D$gaӍt&'UVSu UtMtJ҉tDF%9uCJ9uMFJHBFBFBtDB[^]Ðt&t$T$ $ps[^]Ðt$T$$t[^]Ð$`븍U(uu]賊 }FuUtuE08u:Fff|t$D$ D$$RGD$$ot$$D$r@f% fFF]u}]ff%~ fFFGf%f-fw<$:XWtBf%f-fw$X UWVS,}vuU $D$$UTffMHff MfH xHUP(Ht<2ud$t!,[^_]ÐUUit&,[^_]t&D$$UamU$$k8D$8h$~USEHõPff t*$jD$$D$rf[]Ít&f fPR$P[]fUVS݇JD$D$b$gPtPD$D$$k@%@=@t#D$$ ?lp [^]Ðt&`D$$D$`Y$`[^]É'USËE $K$D$ED$Te[]ÍUS$E؆EHff tZf t4ft-$D$$D$d$[]Í&jT$$E_oEff fHR,P$[]fUS$E8åHff tRf t,f~t&$ND$$~D$Vd$[]ÍjT$$EnEff fHR(P$[]Ív'UWVS蜅 ,} D$$=Q@f% fF~FFUUXFEFEG6UM؉t$$T$ocD$$D$ETcD$$ED$9cEEM؉U܉MEUD$$rF D$$wcD$$rU܉B D$1U܉$CcG@Uf%fEΈJ}Gf%f@EƋuɈF}:tuE/E,[^_]Ít&fЉMM&'Uuu]賃 FPfftsV@ucHt]u]Dt&Hffu@@t׃@V$}D$$D$aVBFt&@u,t$D$F%$lz@X3Ƌ@.'U8]E趂#u}Ht>v]u}]ÐPff%$O$u$_$d2H@@ $0aYdD$D$ $lE0 ;!+9 )ƒNPHUD$$#aPtoPt&ҁT$D$$HT_H@@ $0.t&$VvD$D$$b&諀‹EE}EU1SUVÛt $zD$$`D$^[] Uuu]E mtKtCt;D$D$$+^t$D$$WH]u]Ðt&D$D$$]]u]Í&'USkؚtJPff tf~t ftf u(D$$pvD$$D$x][]Ív'U(uu]}~]~xGFPU@XljFEKWffGtGPfft]u}]Í&f fPP͍vf fWW뜍vU(uu]3~àFuFD$$D$&PD$$D$N\4$E`E]u]Í&'U8uu]}}FVf%urtzNQffthf4 @tff%fwN9uftft Nf]u}]Ð4$_tpD$<$D$O[ǐt&A@hD$D$A$MD$<$D$N4$ED_Evt&0D$$D$NMt&'UWVSD$$D$YG$@$H@@$@ >W$WG @$@ $0E $]Ut ǀhM9~ $.I<[^_]Í$ MԋAEMttMԉAE M AU$D$1dD$QZU܋MHFU܉4$=G Ut&$Mvt&1*dD$ D$D$$LvU܉4$[G U$fzt&FdU܉D$$YU9 UWVSy,}UD$$EGEUf@f% ЋUfFFFt$FDE ~ D$$WMɉta $asMFEAtg1(t U<u]U4$Ut&E~8,[^_]fUNV0fxэ&ȉMxM늉4$1[8UD$8h$nt&'U(uu]Sx}} t ytaD$$\|$D$G%$aD$D$$‰4]u}]Í&Y$ rt$ D$$bD$]f&U4$|$Eu }E }E4$|$]vUWVSwë8U'Gf%f`Ew@ @qv t&t&"UBf%f=U fw BPE Gf%fuOU$Y<[^_]G?xUBf%f`&\<$ƤDMAf%f` $mDEЉU.~UB PR"EUBf%f<$XMQffL$D$$SjD$$ ^t&$Ho<$>ot$ D$M$L$CZ<[^_]ÍvB3PR @ 80fRB< fv^dD$$U6Un&RBf%fRBf%vvMWwEH@D$$?f@f% fBzBE܃BMBEBEG(t <0$UE؋UD$؃`T$$QU<[^_]usfH[t&t&uVv( t&Jt&/v@vvpB f@vGt&N$ v#n7OGPJffB@@$BEBAf|ddBЋ8T$ $ D$kD$QQ$MHz@ 80&$Pjv$t&3jvq$HfftUf#tNfuWx fɍvt&UԉpUKUԉpU fuH t&ff릉$,S8D$8h$f'UEU D$E$EUWVS,}6pãu 6Mp+@PtXtvREUEGHHtj4$U^RE$SRUBf%f=tb,[^_]uC ЄuEUEGHHuUwU뇋P̍t&T$D$$M,[^_]‰Ít&Ut$D$$T$ APft@ 80bfD$$:@f% fGwGEGEGUGU(t <$tu>EFUP|$D$$MvLUUM‰^$f{vEt$D$$D$ ?(m뀉mDmt&$<$;P8D$8h$ct&U8uu]cmЈ}FH$Dt @@PtBf%f t]u}]ÍvzyD$B D$U$QU@%@=@uBz R$ $ ЉD$QD$$EkQt$$‹ET$UD$ 1UHBf%f lfBz BEx F@F f@PJff zJ H B NHFE܉U4$nNU$cNE܀H U8]kuu}4 F#~PGf%ftzf=ttU<$eUF t<@ @t*$%2D$$FD$@VBN]u}]Ít&F4$qMD$$}6@f%f IfB$BBT$UM|$$R@f%f JfFM(FUr`vU4$LXD$$GD$HUFU4$8U&UWVSEe M1ɋU iA}E@f%f#f1f!ZtBf%f=UUBf%f#"@E4MQffUB!4 /MD$$L$uGED$$4@f%fG@xGE$c4WG% |}M@ ˆWGEGD$G%$VG UB!u4 EcUB8<${bUT$D$B%$PMfy $RT9P%D$$3@f%"fGG4$aOGGUW ><$aMA$uF(Ue3E{[^_]ËrBf@9uAJUBf%f=$5Ef vFf%fv> 9dd1EEubt&$@t?fGP R E‹@@D$E$1 Ett9Et}Gf%Gfwf~t9ft3f=t-ft&Pfvf tu90vtAf%fuދu f9EufuEtUBfx$MI <$_ut$D$F%$Mf/Sv ˆWGEGt&UAz ?zH t6$B t(KRUċ@ D$T$$a|$$%MAE$tG&PMi E8cBHM;J@B$G6EvMVyG @EЋG EB @E̋J MMA M%E4MG AMAB fEHEPEU }E̅l d EЉE̋EEEu MIEE1t&fB=uMЅɉȉMM1UUEuMM19EuuFf8;9;}}ËEEEpEf8uπ}/E8IuuEfỦUUU뙋MAA&됉bbUJuU}uOMEM9E MtEH@U$D4$DEu ŰEЉU;EuHkD$$ |$ bt&fE̋UЉEEUĉT$D$$^`Uu>Ẻ$LD$"D$-`LEPEЉLD$"D$<$`LE dD$ $]MЋUMEEẺtz$,\<ɃiM EEDž\|u E̅ Dž`}# M1҉U Em؃tz݃|z  $Q|D$X $L\LxE9|# |}ȉuƉ}1EfE4$LHD$ ED$)D$GLHu9v > D9wu<}D$ |$1$LD$$LE։E1ɍEĉuΉE& M)ELHD$t$$8D$ +ED$ED$x$-HLt|EMED$ $D$_8MD$ D$L$xH $t-H+ExD$ D$E $D$J-LD9HC;}uELL$D$$7MD$ +EL$D$x$,MxED$ L$$D$,MD$D$ $b7xD$ +E $D$ED$~,xxL@ E@$EEp UtU|UEu#}E̅ZU9U ;Ep9UddPdhdTDžtEEEEEdl9}UMp+ET$ UȉT$ $LD$DLNjEEM9pv 9}19usM9|uMEEtEtuhMLt$ |$D$ $0*L|:9}U)9urE)t9O… 8L$ lHLt$L$M|$ $)HLM9v2v(vvv уvB=v+=fv =fv=fv փ9ɉMu9EBupdMHt$ T$|$ $(H$|M+EuL$D$ELt$ H$BLHƋEEE9|v 8u1ruEdE9poE}TEMEtE= w =MAL$ 0E@L}X|$ $T$UL$T$)NjExUtUBB)xtxBB }t}t M̅.UtUJ@\ $P`$P};EАt&D$ELHD$E$pLHlEH^t&PEL|$t$$&LEM1Etf}Ѕ~}1ɍfB;M|E11u$utAfBv= fɃf Bˍvt,uL>f B붍u >IuufB뒉WkD$$ 6]EH MdU̅YEЋ|MDžxE̍|pMXjWE̅}uMI11Mf)fẺE)~3E1҉u 8t&ufVẼ)9|uEMEЉMzE4$LD$ ED$)D$>LDHuMD$T$ $EHEЍUċMT$Eĉ $&\Eĉ|\ERt|tUDžxpM||UXMIM $ *x $@ET$ $HD$ p)ȉD$=HMȉM‰E)$7$ 7t&9x0UEUUt$ND$D$ $D$D$dD$G $AMUĉEĉT$ $c%`Eĉt`EEEL$MD$ |+E $D$:}`tPl[^_]BtJE ff#u$UKUD$@$T$ D$6}`u$KD$$`D$/l[^_]Ð&UWVS,u6QãlF@?Ff@x$3~GffWGD$$U\|$D$$UNjF;F~GWf% fG@4G<$JG! upW$UJUz<$JGFf%f=mt[8,[^_]YG@qkD$$ut&,[^_]Zf4$3륍t&~,[^_]Ít$$D$G9W"&$:D$$D$4%t$$D$9Uzt&WD$$KD$$D$$ljFFe$7E UWVS,ENCju} tPffD$ D$D$$$t_Pff fPPP(t<2uZ$P9t4,[^_]Ít&P$EE뎐t&`t&,[^_]ܨ$08D$8h$D'USM+iED$$D$*[]Í'US~MhED$$D$*[]Í'Uuu]3MàhFf%f=t]u]Ít&&D$ D$D$$D$$D$$%t$$D$&5D$$D$)]Ɖu]Ð&UWVS|EvLg@EЋH(uF F׋RuWff ftfuQff[fEEEE4u ‹Vtt;t EP9Q|uu"eUee}ȉEEEEU9uX _u"UM}ЋxuЉFMUtrff+bUBEEEEgEE@D$ ED$@D$PD$UċB D$$MD$D$$ 5MBvU(uu]}06ÝQFtfVt_Bf%f~tf ujNfftffƒf ыfNF4$g Ɖ]u}]Íf=tf tfuB@fuljT$V8^e$>fUSN5ûPE$@txt[]fÍ&PfBttJ []Í&RvU(uu]}4MPFxtOt4$r]u}]Ðt&ìG܍&'UE]u4OptPfBt'tJfft$]u]fRԍvB@tމɀHbЍUE]u4pOptPtJfft$]u]fB@tɀHb؍U8}}]u3NGptFf%ft<$]u}]Í$,/tՋNGt1Q F\FD$D$lT$T$ D$$눍vUSE2UN@tEPRt;Rt4PffP`P$U[]郍v$@PJtQfft[]Ða[]Í&'UWVSL2ùM,Ex$Et+@t%ptv4$D$|$vuE,[^_]Ív'Uuu]1@MFtF@% t+ tX4$t&]u]Ð%t;=u܍eD$$flD$$P뮍leʐ&UWVS<1éL,Ex$Et#@tptv4$|$<(vuE,[^_]fUuu]0@LFtF@tPtBf%ft4$Q]u]Í&D$B$ҍvU1҉WVSj0K,uFf%f=t1F@FvFf@$UR*U4$UUƋt F@f@&HGf% fGUGMwOGM܋Gb9D$D$$D$D$$U^U@%@=@tRGFV W F@P֐4$D$0&vu,[^_]Ðt&GFD$U$G 뜉4$UUƋ@@HAf%f-fv,[^_]8&uD$$UMM܉NjFfU@f&$UEUt&Ff%f=mtP8,[^_]7D$$UMM܋U-M/4$밍e$#&U(]E-Hu}$#Pt%xGf%f=t/f=t!f=ui<$]u}]Ít&ʀVD$F<$%D$Gf%ftt;t2N@Ff%f=mtJ8D$4m$"Ff%f=mt(8D$ m$"4$븉4$ڍ&'US$EX,G@@t%$PJQfft$[]f$[] $EEUS+kGE$[]Í'US+;GE$k[]Í'U(]E+Gu$6P@t6Hqtl*ƀu5ʀPyxiE $E]u]Ðtفt6Pffmt88ҋD$pm$:!fʀP@@yyHf$ʍ&'UWVS,u*#F~F@=uu`D$D$$$$D$$~D$4$E E$w$<$D$D$,[^_]Ív뉍4$Et$@tptt&4$|$!vuE$ $,[^_]Ív'UWVSmy&c9WYBN&E$D$"D$#UE$D$"D$#Ub'U(uu]}$=@FtF@f%ft4$\Ɖ]u}]ÍvD$$D$D$D$F%$4$lj뙐t&UHuu]}0$Ý?FF4$Ut*@t$xtuE<$t$$uuNMAEԋxt7GOf%uo$t`f tZf~tTf tMf=tGEԉ$%Uz&VBff% fVF4$Ɖ]u}]fUWVSUE #Í>u e M1ɋ}EE}EUuEEtF@ @ EEtG@ YRU@ EUD$ L$F$9EEtD$4$. tD$<$ }tuD$4$ }Wƒ U(E}D$E|$$MtP҉PuEt ǀhU9~$Me3 E Ĭ[^_]À}tUt&M@<cYt&u#txteD$$# EMuD$D$ L$4$O UUD$$1t&tt$@t&XcD$ L$D$$EEfEt}G x xEuMtuE8u }v1UU@${ EM}$D$ L$|$6 t }}$fb$JxttBU}c@=htEЉT$|$$$tHMAA EFM'U|D$D$$zMp P$fH<fH<MB(?3$su4$(}tPl҉PnExUtD$"T$$tEt&tD$"D$$tE3t&$v$xv@Efvu@vD$D$$8|$$D$NjPu$$D$D$$D$$2 U|$T$ UD$ET$$+ <[^_]ÍP8uf$ _UES$EED$ E{ 'D$E D$E$$[]fUWVSL ù'D$$D$H@D$U$D$ MVA t&<$xA H<$`CA HW 0D$M $-dfD$ $OD$$D$E'UVS u tD$4$>E$EEMt#Pff t9L$D$$ fǁǂ [^]ÐL$D$$$,H빍&'UWVS,E3@tCu ED$$fǂǂ,[^_]ËPp;Ptvz,u$ 6tU܋rpf}fD$<$uߋ}fUf}؉ED$E$VPv PvPЀ v<_t t&tVPvPvPЀ v<_t<|֍u&tD$<$uE?&UD$$y}}N<=t<;?U ct+EofftfsfE‰D$nD$$ b}1t&'UWVS,uv}u <$1҅u*< t< t< t< t < t&u֋E U$D$$D$U$T$D$aD$ƋE$ D$$D$t$$D$ D$ ƍdf$t$ D$$D$,[^_]Ít&:}< t$< ft< tt< t&t< uِ+E $UD$D$$D$U$T$D$U(}}]@uu Ff%ftVf|$覽<$D$D$lj4$4 ]u}]Ðt&Ft<$D$뾍Ff%ft"f=tTt$D$@$l됋F@ t@ Y&D$"D$$5vF@u4$D$D$$D$wvUWVSLu}WvK<$U $t$$|$ D$@4$D$ǃL[^_]Í<$XD$$$D$`NjE $3t$$'|$ 4$D$D$L[^lj_]ÍvE PU Bf%fDljD$%$E܋;Eh$uƉh$dt$ D$E$%D$EEUBMQfffu y MAzU2X9u`M}؉E@fV @ 9PP9EF$f%@tfPfvff~fff=fff F$t`;g9P TP P&=t&Gf%fU >$D$$$<$EUԉT$ D$M$$L$sL[^_]ÍE܋ptk1ɍ,z}؉ωU!t&FIvt+Ff%Pfvftf+Eԍ}؄tGf%f=ta}L[^_]Ít&UF;f;u}tŋEH@뼍&Af%fԍt&M $NWtBf%f uMAf%f~?aOAf%fLA@ ?q2T$$,}t&}O@<$} <$D$$$t$ D$E$D$=t&Jfyf ,z$MMofMAf%f$OD$$D$D$$+%8nT$$EEԉ$Qd1F $D$$D$OH DEy=E@@0AHffz$HJ$@J UB@@$gt&,cD$D$D$ |$D$F,$@ t9D$D$D$ |$D$F,$@D$D$D$ |$D$F,$]D$$UWVSL}&Ót 1ULBff#fffu z zBt\JEɉMtIM%Eԅt3MAf%f=#tfuE@@tMAD$$|$$D$1҉EED$E${U1tREu)9iEG<$ HǃL[^_]Ív9@G@EvBffBtP@tR~UrGf%f= D$D$Uĉ$dUċ@UE%@=@`D$$D$%EE`8D$`n$'UWVS)LM}ɋ u fuPtn t&:bu#W: bubW:Vu$  zD$ D$D$$7zD$ D$D$ $ zD$ D$D$$۲D$ ${(zD$ D$D$ $蝲@ $D$0zD$ D$D$ $Zp@ $D$zD$ D$D$ $p@ D$$誡>[^_]Ð&UWVS,Ù,uE x:@8-PHuzD$=$MMM)ȃ $D$ D$D$Lt$@ $ˮm8-~PHo-uxxu&zD$ D$D$$ҰHD$ $ZB @$~}} ~nEUD$$ƋB @tL$t$,@t 8:t tN y4$?,[^_]ÍvD$ $@ @뜉 $D$D$D$@ $hm}uD$ $@@ @'US+D$$2|@P @ $x$Z( 耉$3` $hT[]É'U(]u}詾rE 3t 9u+9uu&}~ E @8-t1]u}]ÍPTt эU]fu} \o蒼|1҅t ;t0]u}]Ít&;ڍt&'USnD$$Q[]ÍvUS>ëu E$[]ÐU]suƍE}׉D$B $D$轣xE%=@t"MRP]u}]Í|$4$E$聮Аt&UWVS|EtEMEMH IɉMg}EtE}EtvT$4$EE tUċMċR Uxwe}}}GUąftMċAPAz|[^_]fD$4$E넍v֍zuzD$$‹@% D$@D$B $EED$Eĉ$'UċMċR UpE@ ED$/$-zUvfu}ED$Uz$T$MĉƋAA+08 \;D$D$ D$tD$4$učvUBB7$輸*&M $pED$E$}tF} D$t$<$ٺt@D$t$E$uȋMt!UBsBu $}|[^_]Í{Eԍ{E؍{E܍.{EEE$EvEtIEԅtBzuԉύt&D$$|$UEĉ$UE‹uщEGG<$4&EĉD$U$|[^_]ÍEĉ$荘|[^_]Ðt&$ UUE $ȶ|[^_]É<$H0vM $5D$/M $UUH.tEx/ufv5{D$<$D$ D$Uĉ$EVD$ D$ƍ1}D$4$Mĉ $E"vUĉt$T$M $j3t&"{D$<$D$ D$ 莢Uĉ$E&D$ $UU@ @EuEĉ$і |;u8M $蝖{ $vUWVS:t[uB<wː:ut݋u밀 uvE t-pt1<[^_]ÍuÃum9uE  4$UȈM<UȀ=<D$ +EԉD$EԉD$UЉ$YM̀mt }}Љ$|$Hu`E {D$ D$D$EЉ$뫋F`Et"BC B E0< N 4@ t z $̥uu &<[^_]ËD$$aQ $?x؀t$T$$tFe F @IT$ T$D$ $̕\T$$赕T$$螕$dG(ttt $躥uG(dG(ttt $胥uG(Ap008|D$D$T$q1ҸIu1ҸdEpuPt=:u ?菖u<[^_]Ë$EHM@< < < v< < < t< t< t< ft< t Uu)ʉT$ $7u>u1>-u}<$Ӭ,#s1uD3"P08i|D$D$t$AEED$ED$ D$4$˺47WD$ +uԉt$UԉT$EЉ$0ƒU܋x ED$E܉4$D$ D$Puu#lD$$ D$$$ILEED$$}4Ɖ4$$ &t& t# t vt t t uf t& t t t t vtހ-t tv)${$u}4$ҧ$ŧ {D$$u|D$$j4J r҃c11&D$"D$<$)D$D$ t$<$EED$e{D$<$$<$G|1yɍ{L$$6D${$!ɉL$ UԍT$)։T$t$ɍ,L$$fUWVS ,8  M);8wD$$~$膓G D$D$5$GD$D$ $`FD$0U$$D7 U4uыU䋋<,[^_]Í&|$<$D$脥t&UWVSl d0+ЋU EE $D$۫Eȉd11҉9r)ƒD$D$4$蹤H UPEں@E EEEf%f GfEE  ЋU Eڃ tȀEڋ08X`D$ $$<` E Et& `ɉt8E䋓E;袟dE [^_]Í+$0$; `&{D$$Bt&Hd9ntU䋃)EpP 2QF FFpp |D$$蝼$dAvv4v|D$D$4$^Fu%_DFt&4$xFߍv4$踂EvEM H EPOdy&4$踠vD$$`|D$T$@ $聟E&UWVS輾)<|@ )@ @ A Mԋ+MQR Uԉ I  QMԍED$ D${D$$й$8D$$ا@ Mԋ+MQR Uԉ I  QMԍ<[^_]ÍUD$)$ HA U@tx t#RzT$$Ђ$D@ @tӋ@ uȍ&UWVSYED$$D$Ɖ$详tFF} 2pB 8pA DžB?G tZr@pB 8%@ @ D${$5t&҉.?G uf҉Y?G j Єz[^_]f4$~v4$ vxftpB !@ 80듍&$ht& $D$`x pA vD$$8@ ]D$ $ @ v $D$x pA D$ $@ $D$˧x pA D$ $覧@ ~D$ $莧@ D$$v@ D$"D$$覸D$$A@ U(]E ƹ3uu}}D$ D$t$<$MP J uJupE t$<$D$D$$D$D$$iD$ D$t$$]u}]Åt@ P u @t&1׍U]ٸFuu4$U 4$T$D$ӣ]u]ÐUWVS,E蔸҉Eu 4$ЖU9tE)$wUD$:4$)T$U蜬U܅u;utEE,[^_]f,[^_]Ð&UH]cueE1D$}|D$$~d@tO|$D$/$t9|$4$D$ Ee3u+]u}]ft멋4$D$vW2&USËD$ D$D$z$蠉t@ []v[]fUWVS躶'<$E |$D$t$!$赮p$UD$t$U܋M؉|$ $表D$ D$D$$軈tT$@ $.D$ D$D$$xt|HP R҉UED$D$ D$ED$$8uEE9EEE01D$ D$D$$t.@ `wD$F $IwF HP8t|D$$<[^_]É$t&EE0WD$=4$t9tՍ@)D$$蘦D$D$ $|$t$‰D$EU܉$\U܀}tzEEht&D$ $X@ @EGfUWVSܳI,D$$NyWT$D$$Da$D$ D$D$$.t@|D$$踟D$ ƍ(|$4$D$D3|D$ $螯4$D$"@|D$$|4$D$I|D$ D$D$ $zV|D$ D$D$$Te|D$ D$D$ $.p|D$ D$D$$0H@ p@L<>UGzD$ D$D$$輄J@ Fp*dD$ D$D$$膄NjHG p@L>UuUBB <$臍v|D$ D$D$$1J@ Fp}|D$ D$D$$@H@ p@L>>HGG |D$ D$D$$謃J@ Fp$P,[^_]Ð&UWVS輰)lEUEEԋ0$˨Eȉ‹x O Eȍ|ML$D$$$ 莨$QfD$D$E$]t|D$ D$D$$蟂Nj@ @tPv ҉P U$D$ D$T$$胩$O 1҅t @$Q|OD$ D$D$$D$ $覜D$ $薜1҅t@H|D$ D$D$$要H bD$ D$D$$r`t@ÇD$ D$D$$cUx}}UM EԋUD$D$$  8#u΀x!fuƋM$EL$dhU UD$ $蔡u>t&< t4< f< < <#xj< u<  < t< t<-@}&BzHЀ v<-t <.t<_ ݋08u HEUEUԀ::o|D$$ɣƋt$ $s|E밋0EH1ҸSE1ҸI uԋMԃyuEEЋ0 m> 4$$‰'E2MԋEQ{ r i t&[ R IƍujEMԉ $E0LEԋMyDEED$$*ƍ|,~M8D$P$B#M$UD$L$#UB%_DB$h$}ht&$ۆviU:U147E4 e$MhD$}$]H$Ex E @udHE E `dƀ9t)E䋃`E t;E;[sdE[^_]Í&4$^Uƒ@U EȋE .$q`D$ $ɏ`E Em*;`vM1Ҿ19rdE̋EEf% fE܋EEf% fEẺD$D$<$u>t&fn$;z`&P;,@d9t)EE tpP 2{F F$F<pp |D$$軅vU )PEPNt&dv+e|(@ @v|D$D$4$frFuG%_DF*t&4$TdT4$s4$MFfD$$~|D$T$@ $qE&'UWVS y$1tBM E $TE $_:4:dE ;)E ;8E ;G`D$8<$s`8E؉ EtICtVv8`M  $)T7[^_]ÍU9~ אm;>|;$d$UP8`f4D$ $:xt&0U@t x U[~T$$T;(bv ;+4D$ $|npB 80F @EId$UPdU ;ibM ; t'b; teb; E‰D$-~D$4$\kE9`8 Ht$$f` ED$"D$4$YE@ @X@ PF4T$$Zv4T$$Yv4T$$Y>t&|;n$xu)t:u0D$<$xYa ; u\t&9+WR  I | I9tk$a|@u@t x 迁zT$$=P$e|@tCd$neY]t&)8ftE0@t x m~t$T$$O$et ttD$$Lt0D$ $W8Bd@t x E[~T$$N; \@ @@ @ @@ @ @q@ i_UWVS|u8g{~$St!D$ D$$]U0?t$jtP҉Pq$_o,`@DD$$dƉE`@E fP`@[^_]Í&U҉08t:u090}4tJfz9t4t/9v+z9w!8u t&ЀxPu9M*t1\8u%9B9[4t9׃+08?$~|@ŪU$E1[^_]Ë,9~Ǎvkc;>|;$tD$,$3StD$,$S0S$H0?u~$D$UAtV04&W9tt29s.W9w$8u xxuAuË0t&0&t&$e1U EGtD$,$RD$,$Q@tx thzK~T$$LI}8z~T$|$$$ICVfB9={@ @t@ u냍vU])Öuu4$fa4$D$D$U ʀT$$b]u]Í&'US΂;ED$$pU T$$tb[]ÍUWVS茂,} 0;+ u/Ut&D$$Xt$`Qt()ɉt$4$D$c뱐E 1D$E$Vy,[^_]ÉU~U^t&UWVS謁,8E~P Hf0 TDWT(txXf((d<8@ndT4<XhTE`T|\@@4@0@X@T$dH@<$D$NG 3GGxD$<$WNGsR G|GH@fD$$;z4Nc衢1*󫋃`|ǂƂ$ulj`,]J$ qu$ ]u<$D$y|$D$4$]F|$$D$r]F |$$D$[]$ t`߉$D$@$@dOЋE$ th~D$$x>u*<$n@({D$$7UX$ t@ ms,[^_]Ðt&D$<$oG<$@v؋G{D$<$oG*<$v؋GTEt&7t:pB 0F<vdt?F D$~$:qf$$*q~D$$qt&D$"D$4$hy몍D$4$YFD$$g@ ft&'UWVSlzٕE狃xAX;_$dt>R0tR \RJ $j\tP҉P3;tStP҉PtPC҉PҍB~ (fP$B҉苳($ ptP҉P;tC\0u7t$o2u$oEuT'Ld@tP҉Pu$Yd@[^_]Ðt&$Sht P2҉Pu $CYvhtt$Tǀ8pPL$QntP҉Pu $bXft%PV҉P&tP)҉Pu $Wf`t P҉Pu $Wv`4t P҉Pu $Wv4X$,mPt"P|҉Pu $=Wt&PHt$Pf҉Pu$V& $lL$~l$hlLdt"P҉Pu $mVt&t$P҉Pu$?V&t$P҉Pu$V&t$P҉Pu$U&t$P҉Pu$U&t$P҉Pu$U&t$P҉Pu$OU&t$P҉Pu$U&dp@0@ (ppt P҉Pu $Svt P҉Pu $sSvt P:҉Pu $;SvTt P ҉Pu $SvT t Pj ҉Pu $Rv pt Pb ҉Pu $Rvp$(h$ht P ҉Pu $#Rvt PZ ҉Pu $Qv$t$P ҉Pu$Q&0t$P ҉Pu$Q&Dt$P ҉Pu$_Q&lt$P^ ҉Pu$/Q&Pt$P ҉Pu$P&Xt$P ҉Pu$P&t$P ҉Pu$P&t$P^ ҉Pu$oP&dt$P ҉Pu$?P&t$P ҉Pu$P&t$P ҉Pu$O&|t$P^ ҉Pu$O&t$P ҉Pu$O&|t$P ҉Pu$OO&t$P ҉Pu$O&t$P ҉Pu$N&t$Pn ҉Pu$N&<t$P ҉Pu$N&$0DlPXd||<d@(ttt $fAdF,F($\FF,tP ҉Pu$@Md$@t!Pc ҉Pu $Mt&tt$Pf ҉Pu$L&tt P ҉Pu $Lvt PB҉Pu $cLv; E<~z hX tD$D$$HS|@t D$؆D$$Sv#2bt!P҉Pu $Kt&1R ,@ 004049,}䋕0$`B BBt#P҉Pu$JxF4$>FF4$>Fx4pF$>FF9uڋtt<`@$_F($_F4F(F$_FT$_/($_\$u_$S_$A_|P tЉR u|&p@$^$^7u$^($^$^$^0H4L 1tt&$X^uꋃrt7F>t~ gtV x$^4$^uԋJ tC@ t(@ HɉM)J b@ $]$]$][^_]Í&[^_]ÐVT$ VT$4$T$(E4$)]($$MJu$=Jt떍&8vPv`8QUԋIM=vUMB_Qt $U럍t&'USU VrB @ DUD$ET$ U$T$zP[]ÍU(uu]E @Víq}t\~ uV t) t<t?~ t"]u}]Í&~ uމ$,Nҋ~ ċ~ 뼃t/ t z?eEЍT$$Kdۓ@f%f-#fГCōvUSkUpvP []Í␍t&P RuD$ $~Bȍt&P JuD$ $^B먍t&x tD$$BB[]Ít&P tߋRrҍt&D$$BWvUWVST p,$@@ H MP|ҋtא1 Ɖ19u 1ljUD$,$-MƀẺE1Ur|UEEB@ u$D$)$ F|PB @@B+9zR  I  I<>|OAdD$$W2dUtt;tMI> 0);E6}NM OEGx EMGOdt&|E@@ 9?+WR  I ` I|UMEt&Bx 8E f@ED$c$UM5UM@UHUU}UM1EEEщMEČ[^_]Í&} E@ n }1W ~BsD$UăD$l$CfE|$<$D$(}EGU WE LtItEɉM} G G @ HA 5E񍃤E}G cG @ VpF 1&ɍW2DMĉL$Mt$|$ D$L$EElD$$UA$Utz bD$ H$;MMU}}vVt&U?z1Č[^_]Ít&MĉЉM1)4$&vuF %pxx*t&E@ ex̍t&}G @뱐uF  @딍t&E9ED$D$U$$Et&UB @Dt&MA P!MMA~@pA 80}=|}>rU EE&D$D$D$ T$D$@,${6 HfU}H IU9P UEЃ)1v4$ cv|&|MĉMaМuSvz 1@&t&D}Pet&P fB 1}2z ~A}<}EEEEE1E&UD$}<$36D$E$6D$M $5D$}<$5vD$M $5VD$u4$56U Ѓ }ĉ}z uEωUEt&}CvEt&}X}$+$EEE ‹EE 1UEEqADA8EE$UMk+$cUMED$ D$4}|$E$UM92UM@ 1} EEE1EEEx Gu<Ey E}U1EEy$}U1EEE A|ExUEEEEM Ty$}uA(EE Ey(}U1EEE }CxUEEEE!M x A DEx F tU҉UM1MEEMEEE M $6A EEEEtE D$ D$D$}<$/UM\@\F@F2G 80%$UM71MU}EE} EA$E EMy(}EE f4yx};x1UEEEEM }x1UEEEE M p<$HRtBQtx}}EEE@tx t82zT$$$vEE T@ @t@ uEE*<$UM3UM!0$1U1EEE FUWVS:V&_;d@P @(0 $V$(d4<4T}1t} Çt} 2H|EЋLT$D$$T‹tJ $ `D$ D$D$$Z@ @P8t&D+D(D$ D$PL$$+(bHH<D$D$0D$ Lt$<$D$H9@Ѓ E0E@t vt&ǁ<򮋅TD$D$D$ 0T$$уL$ tD$T$$uD$$ D$$E HG 8uD$<$@ fT$D$$HB 8uD$$w@ H8B 8uD$$?@ |$$4$} dfzU&KzT;fbHHG 8uHD$$ @ LHt$D$T$ L$$} t } 2iD$$?D$$H2ēf D$<$# @ @B =f$B%z D$<${;}:}tW:}dW:PWW:PED$<$D$<$HG @uD$ <$$ @ @D$D$ D$HD$$VYHy ?uD$ $ Hz @ 0$cHA HHH@ @xMB 8uD$$` @ |$$IUVS u49Vt2HMF u U L$$t$ T$? [^]ÍED$"D$4$!MV뺐U]Y8uu4$U4$T$ U D$T$]u]Ív'US{8xH D$ED$=$ D$ D$$[]Ív'UWVSu E 8eU1ҍ~TTd$PD$ t$D$Ƅ5d:Ƅ5e:EP|$D$ D$$1t$W B@ t+J P TtUe3ļ[^_]ËT$PD$ t$T$P빍t&<$ t$‹T$PD$"P2:D2:E|$$PD$ D$PǍd9$&P$ VPBG @% t&US$EU6@ t%RU@ M T$$L$$[]ÐUT$D$"$QUʍt&UWVSLU5uB u $t&@ B 8t؍OMԋHTE܋A E܃0D$D$D$ ML$E $D$U UEEx t(D$ML$ E T$D$M $UЋMA H&@ 9EA|A3MA @A @ B t5H B Dt%@vtE䍻V$P TUxM"vP rtJ vEED$$UQUЅtxD$D$D$ UT$M $L$tx zD$UT$ M $t$L$EEЀx `CvMԉT$L$ E$D$5t&MtUB xEfEL[^_]Ðt&EwD$ ED$U $T$tP rUt MQ ztEEL[^_]Ëy$tRtJɉJFMQ rQ M܉J EEL[^_]É $UUD$ED$Uԉ$ $ $UUf}UJUJ y:z$-Q@Tv$U]UЉa$E(E)$EEM9H kJD$D$ $N C1M܉H E3vUWVS y1LU}EћE|҉Mt$B< @ER U1D$ D$Eԉ$D$UU̅toH yx$}u@I u9t3M L$ED$ MЍ|D$$L$U(U@=tMPE G UPL[^_]f=H B D)HMЋ@$v@(D$D$D$ 0D$Mԉ$L$U8P Ù t:D$D$ EԉT$<$D$W $UrỦXG 8ED$UЉ<$T$fD$<$D$ D$D$ ML$E <$D$L[^_]Ðu 1L[^_]fE1E&E$D$"D$I1҉E&D$<$@ %&UXEM]S.D$ E L$Mu}D$ $~tЋ]u}]Ð}t}ћEuu t̋MԋEUD$ D$L$$Ut@ @p$tM0xBD$ EM UD$D$ED$L$$UJEME D$ L$MD$ $ U듐&U])Ö-uu4$fU 4$T$D$]u]ÐUH]V-uƉ}T$UD$$Ut]u}]Ðt&T$4$D$$|T$UD$D$D$0D$D$ D$$ U0T$D$D$ |$4$F PttH$UD$D$ D$It$$U@t@ u!1U$LU$D$@ I DD$ 4$@ Pq&UWVS\EUEg+%Ez GʋU M~U 1EỦ&<:BJt<'uBr׉uủ}ЉMȉ}DU+U T$D$E $UUEUȋM+ỦEЉUȉMD$ MȉL$ẺD$Uԉ$}t@ Hp$\[^_]Ít&BJ<:(rB׉u X=$PtKB tEH B Dt5D$T$ $@ REv1ʍt&u̹ft~u̹ ftlMEUԅ*MA P A DP@T$ D$ẺD$$mt&x\[^_]Ã~4uйVMȋE+MEMȉEDž@@끅tF 80oDDuSttKDžF @2 $3Tq4$tJF tCV H yy k|$ DD$LT$$L$n븍vU8uu]c!}u1]u}]F t@ F t֋@TxU@ D$c4$Et@TH; t:1} D4$D$5tbD$c4$T@H; uƋUU9PuCU |t tT-f4$t&3L} Df D$D$4$@ @lD$4$D$jt@ @zU_ U勁L]Í&5? U勁@lt@ t$B t4]Ív'cUwҋt&t&]Í]Ív@]Ív ]t&Í&]t&Í&]t&Í&]t&Í&]t& U1]É'U(]6}} uu$ D$Ћ]u}]Í&UWVSlEU cEEUeU1҉EE8Ɖv'9uw#t&9uvA< v_u 9uw.t}9uʉv5uċu t t t vt u 9ƍvw֋uċU)ƒ~ 8=A<wuUe3l[^_]ÃAvۋED$vEEEč|D$E$U֍dUE1҃9}ĉuw,fЀ_t0ƍ4ƒ9}v֋ET$uUD$$AD$ +ED$ED$E$`Uv UJ F9EEvS>.uN0< wDuĐ9uDPЀ v<_t0UE$T$JEJEHD+EUD$VD$ED$T$ $UJfHx>FU+ED$E$D${0{ 'UWVS)\P;pxmHp9ΉM_M)NHt9ΉMM9Mu9vpxpx t t t tހ vt֋@pE)E't&jf1EEЋED$$ $$JR=R 0R T$$ẺL$ T$EUԉ$t$ T$̽T$hE̋JPMԋrT9}$ I)HD$ HD$$ >pB x$@X@ Kx B |$D$ٽ$$ qfǀǀ\1[^_]f$@@ @ D$ܽ$cvHtMЋMЅtKpp;uvCu+MЁ~1ptpt t t t tހ tِvfFv t~x0 ux1EU1c1EEsMԉL$JYL$ RX$ẺT$T$4BTEvp81EMMЍ$$ẺT$L$Eot&UD$D$ $OŨEB @T$D$4$}Yv1<1vU̐t&CUʋDH@tlEUD$ D$D$4$v Eu1 r1EU &D$$@@ T$D$4$똃@D$$@ uxv'UWVS|MBp9wN;J|wI9t:t&9эvt%x u$B‹>9uۋJp[^_]ÍD$̰$ET$4$X}$M f H<$U@$UYUB0tGx48P8E,[^_]fUWVS,Ù\EU܋UE؋@ @Et4 u ΍|M8EMҍMu䍋 DщT$$t$aƋF $FF E\[^_]Ë tu D$D$D$ M L$ut$}<$U%UЅA<fE$UU6ҋUЉu}E}܋|@ 2@@ Au؋ +7qI 06v 4706v41|U<$ ;U+) t}}~EFM܍F N H>D$}ԉ<$UJ>UЋEpA 0N8p8G ƅH6F ɉ6F C@dpA 8kPL$D$ D$ $UXpUЋ8G 0 A @ $U}EGUv4$E\[^_]Ðt&uE\[^_]Ít&A f@@*et$}ҍ DЍ;|$ L$T$$Sf4$E\[^_]Ðt&ɉ6F E0tF;jUZ|UЋ8@ M䋋+9MyI M} I } I |F<u[:t&@pA 0@ 80at$4$D$U9UЉk&E]D$M܉L$u4$UЉE8UU/D$E$D$UfUЉEvF @}F~f{D$"D$$UUD$)$ U|HA UOU?$UUЄu D$ $PUЋ@ <$D$U2pUЋ9p G D$<$UUЋ@ <$D$pUЋ>H G 0D$ $UUЋ@ w<$D$UUЋp p8G D$<$UxUЋ@ D$<$UZUЋ@ g<$D$U} Ĝ[^_]Ít&z yu8z nt&u.z uu(z mt&uz buzet&uzrtv1[]m< wd<w8E<3wC<4wPB<5w$a<rt&D<3RTt&A<32$t&U<"t&fzwB\u;uԐtn4}f9M9uԉVЉ}vH։9Ux\u9Uԉ|:\@\Րt&4}̉EЋUf:y3M̍;1҉D$$1|$D$L$ D$誦ǃL[^_]Í@Ew f}\+O H덐8 T$D$G $!E}뾍UH]Yƻu}xtoEt~tyP\fx^P?x ǀ?y <$uU)9UhD$EU؉t$$nUؐt&9UAUPU~UӍv$~B u7RlB V~@=&JvJv _t&M:A:Tt&~:V~$E~:UBU4~tV~@=n<$nu#!UUE+U܉,[^_]É<$}uNį$P&UVS etOD$ $atD$"4$HZt$'D$ D$,$vBYH^v$E^BYPv$@EuE땐t&EuE넍t& @א&UWVS<é,UE<}䋳3ft589W|?}@ 8;}Iu,[^_]Ít&tE zD>9B t$U B D$$abu <8xF 8M @,[^_]Í&t$M $L$P$,[^_]Ë} @D$<$D$}u%D$U $|M$u1 UWVS輌)\EEtR ŰM̋Jr8z(MӋMP6EԍEEȉ}BMD$ D$A U$蛀UEE t&RRv!}Ƀу)ϋN <9O(w_}ԃ T$t$<$l}ỦNjx(\[^_]fMxB(}̋G BYEMR MĉϋID9G }t`ҋ}ȉȉT$Ủ|$ B D$F M$TM}MJPtNF T@}̋ҋ}ȉȉT$Ủ|$ B D$F M$豅M랍t&@뼍&EP.vD$ẺUM$3zMU*Ủr ED$ )‰׋U L$t$$XEM̉D$ $CJP|$$bud$t$Mt&U]fut1t'Rx@ u9p$t$dP]u]f`M@$$[z$L͉'U8}}]cФuu u1]u}]Ív ttj~vLx$HM@D$U$}Ut$D$$'i냐t&UD$4$gU뜉U$qUfUM$ ΀MUWt&UWVSjף,D$U獃W$9S‹@|4$UM)D$覄M܉A8U|D$D$$hUMH@(@l@D$@l$D$h@lH Bl@ AB|@l@ ,[^_] UWVSLyEExlW H|M܋HpMM)щM܋M)щMȋHt)щMЋHx)щMԋ)щM؋)щM̋ɹEM̉Mċ)щʋɹEʉM̋U1EtTE܅u @D$|$$fcG XEW ?}׉x|Eȍ<xpEЍ<xtEԍ<xxE؍<t }׉t }̍4:t;t/t(;tE+EU܉$1vEL[^_]Ít&HpMH|9MMXM;tǀH|MM9t ǀ@EEEEEEEIt&G u|D$D$<$eEu9Et $#bǀLH8u:p:u1&D$D$ D$<$S1Ef~D$UD$ D$<$RU1ɋEE܉T$<$D$tD$UD$ D$2<$RU1ɋpEj&$PyoD$̰$y'UWVS<艃E_ qpy|E<#E&< < < < < 9}qp$@uU4$ ~$iU qpy|}us <#h< t9uu1  ֍9tU!U 믍&E 뛍vtUUE s Ee qp<[^_]ÍD$̰$@x&UWVSY,J4t5;J |0J|9rp9vv` t tPJpMJly Bpfx^t@$lM)ϋJlBpy zp;JpvJp,[^_]ÍuUWVS<EeU1Àt6~  @ t@ ft;*1$T$D$$?$D$$|$ivW:1D$ D$|$$RtP J t7t x D$D$$t>G|+~:=OD$$D$?U@@@3DŽtP0P3P2ƀPp:(N If1Ue3<[^_]Ívu܋BFf=tf=tA<vzpB38(x&닐Ru>v@ v@@]0f1XHt&Av=:Ƅ>Q&x>4 UWVS}'LU䋏MD$$D$PM̉H@MЋ}P0P3P2ƀ}ԃ<[^_]ÍE@EԀ8(t@3@t&@30'UWVSyg,x3t1cOED$L$UK$6WUJЀ vMvt<D$D$$1z,[^_]Í&P0 w}ubDŽDŽtJ0J3J2Ƃz,[^_]Ít&;t}t;tvLD$D$$1'U(]yx}uU䋋$1F1?9WG1UV3urprtfBFuE8(t#8(t%]u}]Í&#'UWVSUeU1w$ t t t t&t uNj$9qFqEHltA u#4 u!MEMO$A uύEЉUD$<$AD$ |$ƋEЉD$E׉$HU}$ IHPMɈHXEMHYU$nUEx OpuF%_DFE}Ћ2}4EE}}8Flt@ t$A }M׍}̉M}M+H EЋ}M̋D$E|$D$ FluD$U4$D$iUNj@lH F M;ME@Ev;E v9v)8 u2u苳$6uF9wfMuMčLuMċxv΃y\|HX:HY}Ew 9Mĉȉ(:M:OXρ}M9Ev@\Mu͋}t\M̐t& IXM8u뵍9 E~Fu+F AEp mM~)}2Fl\}uMhu@N t, Alt@ t$@ t4t}MM }u 6t }O $@AT}Hq;p /PLRUP@ue35EĜ[^_]ÍEp v>2:NYG:NXV}f}ċu}ĉu29~|E}}7+O N u;q|+O jHp  H@< u f$@H|HpU$mUy2FpE84f}?}F|OE+E|E9x h}NXG :NY}M9M}Et& \2GE;F|Mu8NX8NY8M\uăM&}ȃO 9r}Ā\t 8\u9s)ƃMEEMĈAuhvvltF t$0F tE0t&}E$AmE:NXE}M|$U $r`uU2H~|}n}9}M׉ME-vu}ău2E}9F|H} t[\t8Mtq}t&tuE븐t&u:;w|sՀ}\tϋ}u:MtM\M뀐t&u$A느t&MЃ}29~|ru9ɋ}Mu't&2vltF t$7F A40uEx t&@ vH@<  }+O Hvx HbfՋ$ @APMHXEEUD$$`:U@EE $D$PS^MUEЉUD$ |$D$4$(=UH A D$G U$XG UPLMHLE0EЋ}UD$ D$E|$$@J:OX$E1EEE<[^_]Ít&@tF)9Es5EEx|pp)9MvEԉ$UqdŪuډ)ED$ D$L$4$MQ}v`$E,Eȋ|D$ D$M̉4$L$PF,E$UcŪt,ppx|E$UcŪt ppͿD$̰$^'U(E]Fhóu}uJ$,t" t*Jp147Jp]u}]Ë$Bȍ޿D$̰$^v'UWVSg)u$FltP҉PW9tt;t$DtPtG҉Pt]F$^F($^F,$t^4$b^[^_]f$ *빍$*Xv$pH뙍$`H8v$:\U'UWVSf,EJlI 99;Bp)ω};BtvBt;Bxt9t9R| $D$)‰T$TU@l)PEB|BpBtBxt t ,[^_]Ðt&Bx^ǂk&ǂAD$̰$[ U8]E6eãu}Qp9wH9t7y|9w=)щMO)$L$D$SU@l)׋)Px|]u}]ÍD$̰$Zt&UWVS,EdWRlB $ A u8EE 9EEt*E1MUf9uUMku @D$wVU pp@|t$)D$$RM @lHH|EL$4$D$oA,[^_]Í&4 Eyuu 9ujM9EE&H9utPM€XEZ $&| E܉D$ D$)‰T$$ KAE9t'x9ƍvuًUPlU @M܍D$UPpE E@|T$U؉E)ЉD$EЉ$Q@lEE ƋEpup|M9MUzEMUU U;ERyʋu?ɀ׃Nu˃Et&U @l@D+E$,TM +MPpM@|T$)ЉD$ U؉$@PM +M@lHMH|U؋Et&J9y8? J؍<$W D$̰$gWPUt&U(M ]as|uuuVVt/HMF T$L$$.E]u]Ít&ED$D$4$Y_MV뽍D$̰$VUWVS|`{<M}D$$MfHƋ0U$ yQFFFf@F FD$-4$H$UMԋdž1tE džƆ F3t@$xP$ F(PF,G @EW Ou |;<$U4UЉFlljE|;t'%<$D$ D$D$-~lG FpFtFxBdždžF|<[^_]Ít&$ V &ED$"D$<$9]‹E)&E%D$$ZljFl]&OG~l?'UWVS^Éy\eU1ҋz -[r8{YPpF<D$]$!)1@<$t4PЀ w'fQ]t0 w y]ftf99<-t&<$<&JvJvJЀ v _҃F9D )9 <-uF2\D‰D$I$'NED$P$'NEx9-YUe3d\[^_]Àx>1f@t&$&Hfv HOɈavAPvPv+D$L$ $CjE@to\OW:|$$"&cdEƅt&ȋ$ kƋW@ u5@lv@ lGG@<=PD$D$$k!ǁ瀀tǀDBDЉ+~JT$D$ D$$,td f  fdEƅ_fPPЀ <_?$ &4Ws&0< v $met&P@0< nHЀ v<,<}Jt&{J15t{D$($x#GD$4$N#P{[  BJPЀ 4PЀ vt&$It& uOuF?|$$"tA(Eƅ2t&EƅB< &P0ǀ v(Eƅ v'UWVSLUHMMJV÷qUۋU TU@< t< t < t< t< uE䐍t&EPЀ M9MP}PPЀ <_<'<:`RltB t$B t4@<=E$U䋋4ր>x"fƀ>y 4$4Du+E9UD$M<$L$U2UЍ9U׉uPuW֍$MqB u.RltrB tlMuQ@=JvJv _f:WG:aUz::BWGu;4MqtyU9U}Uu 9HЀ vUE8U<$<{UuE;us UMEM8^@EԅF< t< t< t < ft< u/;urt&#9uܐt&v< t< tU$@ @l @ UP@=PvPv<_@lV@ L$@ :uu܍v9$@ @lk@ aP@=wPvPvPЀ v <_t<:uUf9vt&?w<$Ag9w9T<:tu)T$t$M $UV/UUE;ur9u< t< t<[t><{6Mz:zu"Q:zuQ:Pu Q:P$MthD$E+ED$E$9tG>[]cEUۉD$MD$D$T$L$L$ T$$0P H(P $t& ƀuL[^_]É4$//UU4U}HvHvHЀ v <_t <:9r̍į$>F4M $.tE$#>MPv]PvUPЀ 2<_tE <^#P PPЀ <_UU vUU<}EuԃL[^_]ÉRf$@ B<uL[^_]Ë4MuMM">>G<G<@M  $5J}+}D$|$E$6?Eۺ@}#M$D‰D$D$L$L$ D$-YuEv3<${4$v<4vC x UƀMMB<PB< E_<<$1<{)fD$D$4$AU=@l@ B@<=4$zt‰D$V$,(G@z ƂB3U HvHv HЀ v<_u?;UrԐt&'4>9UU_&9UUMD$|$U$64'UWVSKg|eE12NZb=PtppPxptƅ8<~$4B S3PDPD<_48PltB tB t4At$$u5 O@lt@ t@ t4D$4$ D$8D$XT$ $y@,8!%tDWD8+8D$:$|$ >FZ‹0Dž8ff=Yt7f=sfDЋt$T$$$&0D$$ .FpD$|$$YF Ue3Z|[^_]ËFpQx1t@1ƀ)fxD!u!Pl;P@uB @tPp;P|~@@Hpp|9,R:@lz'2,+$V10p Blt @ 4fzD#5Dž(ƅ ƅ4 v4 fyD#. <($5 <#% <@ G8G$B u*QlB 8@= 5PP PЀ  <_8‰D$~$8pH8ht&9\ τX 88Vp~|9L1J0B28B,BQ-t@4ppx<$Q8n W9,G8D$$ -`(rD$4$8F;8v'489ƈPr488ƅ ƅ4[t&y9,,BDf!f8~f8#t0t)D$$"@8$ ?N\v(uDž=Dž$v.Dž$vDž$ (h$;v60I 8)΋,)L09H %84$D$8T$&Q8?OW#8$8{t8?r{h8֍*&\#{#}Q …Buр8)8%98$f9r$)ȃ t&I8A O9,$,t&P nA9wR?-_ƅ ƅ44f0H @ 90)r N N 4R94$8'41׍T8;8~닕 $+4ƅ 8tƅ4t&t3t$$L $D$|$$8'"$}4Wt @. 0T$$4D$$D$F@@ <$t1<@f t)<%u :u9:u f 1t& H8 t$ D$T$ $x W9,8vB9t: AK(8ƅ4ƅ4ƅ ƅ4B8PЀ u<0W0 ]ЍT$ T$D$$$0+w pP;P \0JD(#0O fxD#0Pr;p #9Hpix842;8t8@Df4f4#tf4!'D$0ωT$8+D$$D$ t$i;007D$D$$9 F9\ ƀ9Hp&p@3DŽtP0P3P2ƀBHprHr"p$x8u@3Hp,4700 +H H0ID,$D$)DD$0$'0q pDž(UD$,D$ <$)D${WE$5888D$}$j$t (;j88Uu x+v8+8|$$/ |$D$ $1҉L$D$1D$ 8D$D$$p&A u@A $$D$ $Dvx8tH2\N{}G[wG$.si8Pv(Pv <F:<h<6:<.:889-HЀ v4Hv,Hv$<9<j<9-5D$:'ƅ,Q|9v'< t< t< vt< t < u 9wـ?=u >@Ap4qp$D$D$$rpcs4Bp00D$$D$4,u y3#jDž01Dž,M|V0  4$D$Ƌx3u W蒆$ 9QFQ@3pp"{W!$D$}Dž8"?+88D$ $D$ D$ 8v!(!    O9,8/GP_% @8VB7D$<$DžDžD$ D$8f8#-8 90<#/@|9rU+t&9F+> fuԎP4t ;P m~Eo;p|~rҋǀǀH8,$481J|Jp4B$#H4h8xptWtM?ttw vu2$.882Vl I`Hƅ8L>t ?=Utp>xpxtxxBl@ AB|ǀǀ4x81P4K;P Bxpƀ=8F88{~-$19NFNB3Bp)x3-@;@3ppPp:=-(1҉$®Ƌx3uP4t ;P V^襁$V$@ 9QFQ@3pp軅~&V-x3-Pp;\@[@3pp=Jp9=8Jp1҉$˭Ƌx3uP4t ;P U^讀-U@BL@ +@BL@ u#8v$t!\tx҉t@uڋ@C$ 9QFQ@3ppZ$9JFJx3uP4t ;P UN8~#B @l@ FVH@=rUPv*Pv"<_tFD$$ƀ@P|$8D$D$dƋx3S +@3pp*Px9+;+@3FiBp(LFV~<=4<~4@3Pp!/z3,(z3N?F:6~/N_B9B3BpPp:=Pp8P4t ;P OP3%~.VX @B@3PpPp:=WPp8/@ B3rp ~|VN%,@]@3PpPp:=1'<~B d~- D$B($ B(x3Px;P H(P Y<}<"9<'1<`)+<=V+@H@3Pp&]~4V~=/>wI~HIt,< *< x*< p*< h*< `*x3HJH9t  HH:t r`x|LMx3F8~<<D$>4$;D$ 4$9ID$8$D$D$>|$ D$H9H0<$v׉$8H@<=A<v%A<vA< v_t<'t <:v" @ u6Flt@ u40t뉋$ 9QFQB3rpRltB u4P@=x4$O;^1$4G8{$t&xPcvYQ@B@3HpPp:=#Pp80B>B|$nc9,(‹,t&P)A9wf88D$D$$c@%@=@ fzFu $ D$$ B8@x L$0 $X8$R8< 42D$D$$(FH|F$HV,N$TH,@$Hp;H|tU&LQ)fP`P8(811ƀ^D$U<$0F$ Jp$x, 7H$H,@$ƀDŽDŽ(tH0H3H2ƀB:&u ~:}04D$ |$D$$t @ x B1ɋD$D$D$ D$D$$0.8tG,%=ڃ-R{ rA @ E1D$ @$D$D$Dž0Dž,*ɋ@3'ƀ DŽDŽ,P0P3P2ƀa<E8H8+Bxr|9Ɖ4xj0,8 (.t&,t);4'+8 +0uƋ($T$Jx;a$觜79NFNB3BpiGڳf;DŽ|}D$ D$D$$8A< wCExpwppF:t <>*z3< t*< t&< t"< t< tBp< t< t< t< t < tf_@3xp-P#gD$$DžDžD$ D$8G(tGL$4$D$%ƋfxD#P`x@ЃB0+G BODv(vvv ҃,+8D$DD$0$0r pDž(9y|?: G,:ʋ4 $UB$ 9QFQ,pp n4Fƀ$P|$D$D$跰Ƌx38;p|@3pp$̽0;1S$ZJ3N~V<A=@@F@3xp&YP3p1DŽ{8D$T$$&P1@@K1@ t @ R T$ND$ D$ƍfD$4$J|$D$ 4$D$%8t$D$$5G@@<$t 1<@ƒ H8T$4$ D$ ~:2T$$ Dž0Dž4Dž,b@(0+A BIDv2v(vvv Ѓ,0+D$D4$D$0r pDž(QI8=P3ppҺ FXx3Px;$@Z@9QFQ@3pp@`4$89);8*G1҉$0Յ$9QFQ@30xpBb饹@6@3ppBJp9=w8JpjP|$D$D$*Ƌ@3cȄ@3pp* ~.V@@3Pp޸C$D$ D$D$Zt@ x uxt xsD$D$D$ D$D$ T$D$$t0tFƅ4$Ň8D$D$ $4Nj8Ut$D$$$D$|$D$$t$$D$)D$@$D$8B<@a% F x xxƅ4$0$+w D$ iT$D$ $u$>ED$D$ D$D$4$j1򮋅,+y09P VD0B |$t$$:0$+B D$ iL$+$<$D$u ?E‰D$D$D$4$D$ v1򮋅эy09B rZ0B |$t$$:$$9}pD$ $9$!x @-B{+["ƀfNtf>{Q<{t<[$NN$H8Ή4~@ u/@lt@ u4t B@<=9B<v=B<v6B< v/_t*‰D$4$[-w8@Dž0yM@<~.v~.@3pp Fx39$ 9QFQ@3ppC~>ƀNx[@[:40x{$L"0D$@l$&D$ D$D$@l$,p &@,0;0,D$D$@l$,D$ D$L$@l$v례~/*B3‹ppPp:=49餱Pp8锱 $׳P3M@b@3pp'GP p(P $@3RP< t-< t)< t%< t!< t<#t&tHp{ǀ׋4@ B3Bp)鎰D$T$$$09H8$h^H9t p|鮭Pp8ƀ%P|$D$D$W(B3Bp%闯@3@Z#pp*xP|$D$D$Ƌ(@3pp&&@3Pp;Jp9=Jp@8Ptr<_a< Y<-P<(H<)@<:8<08+8$$$8T$L$lj$$ض|$D$$<$59s)ȃQ $D$D$dua$@ u$Blt @ ,4z,APvPvPЀ v<_L$, G x xx,1P|< t< t< t < t< t&u9rހ?:<H8u >#*y$4+@3Hp:Jp9=Jp@8雬B3s$Dž4(ƍ,@ @l@ P@=Pv P D$D$$Gc0a<D$T$$N1)ȃht  t&Aw}4tY4DŽtP0P3P2ƀpp2T$4$Y808(0FLY8D$D$$8D$$L$I4$t$D$4@LtPL҉P@L0q8:90y3ƒ{}~;u8m<=t&-'<=T"G-4:-ypv4HO1<_\~:@Xgp:fu 8D$$t$$D$4D$4$$y0ppx$(4t4 $184$賴1|$>=ff=t&ef4$u14$t&18H D$D$ $f8$f`8D$$v=+=f8,p D$T$4$8 $r(fH< B3x4C@3pp+qƂ-B|< 8g99r苻$p P(2p @3}$pʍ^L$$OiL$D$$)@L@3pp&@E@3ppPp:=(>եB>@3xpPp:=;Pp8饥@`@3xp?遥~~W@P@3xp'Svi 8%=[84 tz t lƋx3Px;@3 @Z$pp$鴤B@@3xpPp:=Pp8鄤DžDž0Dž4Dž,D$D$4$8$WD$$@ xy&x3*$ 9QFQ@3ppD騣B3Bp?镣D$D$4$=8$蕯fH</ȵ$df1B $hD$$D$8B@@ 9QFQ@3ppƢ$8 $9PFP8GYD$$D$7G$@@@9QFQ@3pp,cL$D$D$D$ D$B,$@ D$D$D$ L$D$B,$@]@@3pp5i@N@3xp'EpE($9$P|< t< t< t < vt< u 9r$tB9QFQ@3ppG<_뵋@3ppGD$D$$aBpG鹔LCG xx Hx>Dž,0Ʊ38:< fxD 8Dž0 4t t'`y"fnƅ4">\u ƅ4'$@ u,@lt @ n 4[ H H HЀ  <_t"DD$$C@ @lt@ u4tnH@=vsHvdHv\HЀ vT<_98vP@=Z4$nS 1Xt&딸뭉4$A뒍H8D$4D$@|L$$D$ |$Ƌ;p|9t B+D$ 4$1ePuh xt3Jz ;A|s* u؃1B 8 Ҁx uB Ëx|Pl@| +B A0@|D$ 4$)D$)4$D$88P$HƋx OwD$P4$4' 4`Dž u@\Dž $ 9AFA@AP@Y<@X< fyD!F03,4 ;H|84u΋ $D$T$Fu,ȉ4$)ЃD$T$OT@D$ @|T$)ЉD$8$8D$T$@l$YPlR PpPtPx Il4A 4AA|ǀǀ4H N x G:u,1$L$D$p|D$@lD$4$ټ;p|pp@0$UhPp@Al0@ FA|ǀǀ A|+x &@ h|Hl@|1+A Fx @ t&FlV|r+p B 8D$D$@l$讻Bl@ AB|@lp @H8Ad,Ih(8@D$ $,$D(449(80t0 u@4ŋD$D$4$舙u+,+$08D$,$D$o44$)ȃD$L$N4(D$ D)‰D$8T$$8R @T$D$,$@BTPJ;H sP T$F $菾F 8BBu$虵@ uT@lt@ u4t@D$F $艖u3t D$4$]pL pN ܋8 $蛖mRPPBDRPP&D40@PBC|4$D$D$~4r@Dž @|h1)p$8ƀ Dž0:4$¸H@=4$ڙtD$D$<$GPA<|D$D$@l$XPlz xtxxBl@ AB|ǀǀ銩$1ҍt&HAAP 84;P4|c@@3Hp8@@3Hp?ć@3xp,驇488 t t t#4t b@3靮@3D$$;,A12AGf$E$7$)y|鿶 +$BZ%19NFNB3Bp%鍆@3D$$c,i@3D$$?,E]8t }BpMBp@p$)PT$QD$ T$L$D$舮%$e$q$t&賑8t- D$ D$D$@l$p8u8i5D$ D$D$@l$螜8t'HD$ D$D$@l$lP880<'\u'D$ D$t$@l$қD$ D$t$@l$諛>$D$F$kXOt$D$@l$šfD$ D$D$@l$5Plz xtxxBl@ AB|ǀǀ49.;1҉@l$0龀aD$ D$D$@l$胚qD$ D$D$@l$Q|D$D$@l$'" ԷD$D$@l$~!Sut&Cv< t< t< t< t&t< t≽4< t< t< t< ft< t uyD$4$4u)Q t&t" vt t t t uՀ < ^$19NFNB3Bp)Fq$xA8AP@=q8${yp$6B3$$&$@ u,@lt @ I46Pv PCh($&D${D$@W$P$試z<R@J@3Pp&i|qpt ɍT$ L$T$$y$豢4t4$躧@3pp:{)4@R@3pp'{@D@3PpPp:=Pp8{fBFB@3xp$n{Ӹ̸v¸뻸f벸뫸f뢸뛸f뒸닸f낸 xn t&_ U Kf?5+ f fFpD$D$$wGB3Bp-Tz4$xFP3ƀppz@3ppEyB3HpPp:=4Pp@8y@3ppFy  zp?=DD$$k}L$4$0n;4Z8KD$4$910D$$ 4΋P|9s#< t< t< t< t < vPً L:t$$D$<$T$9t$$虖|$$藷 -U94p(x 0,'pfE‰D$D$$赱ppƀd_rFpp<,tA<=B~>8B3Hp,r~>Rƀh9w<wʼn$v8(-u+$D$ D$D$q8$Ӯ0$RRt%JtHɉJu$R@B@@ppj$w@$g0P@HPtf@F8A uwH@3DŽtP0P3P2ƀpp-j@Q uk9QFQ@3ppi4@H0<$? <_t<$z@3pp fiBBP7@@ x @8x otx3tPF$ } /Ƌ@ u,@lt @ 4PP<_>$ (t@Ff=t@8#f_PF$%=;Px@3BF"fMf=+Cf=,9(-$%蟬 Љ8yw<;ɋ8D$$$%D$D$f=f=&fP@=[4$褎k4$D[84 $.F04$Jf4BH<&>{8D$cD$T$@3pp %f~>0 $蠑9JFJT$@@$PltB t B 4tB tt9QFQ@3ppRe0 $Ptf@F@3ppe$T$pm@@H S4$腌4$%84$o,0$+d~9JFJ8u< t< t<)P@30$貏DŽtP0P3P2ƀ@pp&cD$bO8 $Owt&銎 6f6Px;fP H(P @3xp,'cHT$$O@@ _@ 8x LQB$ 9QFQ@3 bP H(P Qƀ%)鬧$@D$`8$D$$D$B9QFQ@3ppa$@G@ G@ D$$ܜD$$D$dB9QFQ@3ppSa>:~:Ft$D$$yƋD$ $D$葒t$|,t = ~,~}L$$ޟH?CDݑu$B H ‹R |P @ DD$$G{D$D$$wƋH~ e~ $G~ GP$1D$‰T$$&F @HM臘9F @@L<$4@ uEPltB u4t<}T$D$$iǀI>tً>v$Xq ; u覤+)GWeD$$蔎$T$YyD$D$$h;~zۄv|$<$D$蹈Nj)J|$<$D$萈/F @@L-%~ $P )1.$J DQf 8tu1@ t @ R T$oxD$D$${G$ 9QFQ@3pp\량4(x3pp$h#8@ |@8P@P@<_@<'@<:vz@(2AT@3pD$D$$tƅ,DžDž(D81Ҁ?(8<:<{t!(u,IA<}%An,8cD$D$$ń8xp [y:zH3$/1$8+^ 1@L@ ƅƅ480ƅ ƅƅ ƅ$08< ,< $< < <  8: Eȋ0 $‰D$Gn4t;ƅ$[ti]tR%t@t&ct8|8\M @ƅ4ƅ 0ƅ4ƅ ƅ4ƅ Ήƅ$É뿋88t'D$ɉL$$/D$ D$莁$t@|DЋ8T$L$ $/D$D$E@Lxr8$茗@tD$D$$"%(8PpW8GLD$$D$v@LDŽB0P3P2ƀ8pp0@WbD$D$$Ā_T<ƅ48>=uP P4,t2@tD$D$$#@38ppV@d@3ppPtf@Fd>(tq_8(te$HV4$&1V28{0B3BGBpJt8(t 8(u"U<4$I&U;4$2&fU94$&U:4$&fU@@3ppPtf@F>(`N8(K4$%!U@Z@3ppPtf@FZ>(8(v@b@3pp!T@Y@3ppPtf@FY>(t8(q24$$GT04$$0T@X@3ppPtf@FX>(8(@W@3ppPtf@FW>(8(G@g@3pp!oS4$#XSA4$#ASB4$#*SC4$#S4$y#R%4$b#fR4$I#R@@3ppPtf@F>(8(.Г$4$"FR1ҋ@$O#xp:JXrP$D1#pPD$$![^LDž80(8(As4$ wP8@Lt(Pt/҉Pu$z@LD$f$N\ٍ $N4PpO|D$$e4NjPdP|Ph@T`N 868D$D$ D$<$g뼋@&@3ppPtf@F&>(G58(24$O@@3pp%N@@3ppPtf@F>(8(FVD$ D$D$<$fFD$D$ D$<$eD$@@<$D$|D$#@@@ $bt"fD$ D$D$<$eaD$D$ D$<$jeO@@@tPt"҉Pu$;xx@P$YPЀ m( 8(Г$=4$+JГ$4$yJ@-@3ppPtf@F->(VD8(A@@3ppPtf@F>(8(4$CID$D$$Dž< t< t< t< t&t< t⍅D$D$D$D$ D$D$4$e9$4{4$D$ljD$~|$D$$gDŽtP0P3P2ƀ@3ppH"4$iHj$Ƌ@ u,@lt @ q4^Pv Pi@ u,@lt @ 4HHHЀ <_t딉< t< t< t< t&t< tthD$-$[tI$!tt3?=u>t()򍃌t$T$t$ T$D$$!o4$lFH@=$W%@v@3ppPtf@Fv>(} 8(t&v@@3pp5?F4$(F<}1v@m@3ppPtf@Fm>( 8({P@=4$amu1<_4$|¸xӀ>(us@`@3pp"WE<;2P <}<;ppz$km 8({@3pp7D@#@3ppPtf@F#>( 8(C4$yD@f@3ppPtf@Ff>(VD 8(A1҉$FӼ7$ 9QFQ@3pptC1҉$0z@3DŽ)tP0P3P2ƀALrP AALp 1Dž8,(u!$t< t< t< t< t< t&t΃t4u.< t)< t%< t!< tt< uӋ@L@ t$ B t14D$+4$D$݇D$$D$`8$L$D$t8D$$L$Ak8tY8DŽtP0P3P2ƀ@Lt(PtB҉Pu$k@L@30xp( A$HM$$z< v< n< f< ^< t&QD<,t)<#u,$$T$di떋($$D$?iً@}@3ppPtf@F}>(ZH8(E vK$19NFNB3Bp?1҉$BCRLz'uB$19NFNB3Bp l?4$fS?@@3ppPtf@F>(08(@@3ppPtf@F>(8(p@@3ppPtf@F>(8(@@3ppPtf@F>(C18(.D$D$$ BB3Bp=4$:=8vK$RP@3ppv=@+@3ppPtf@F+>(M;8(f6@@3ppPtf@F>(8(@y@3ppPtf@Fy>(8(:t&@{@3ppPtf@F{>(`N8(K4$ !(q_8(\4$ 2;@$@3ppPtf@F$>( 8(@@3ppPtf@F>(8(Iv4$ |:+4$ fc:4$ L:4$ f3:4$ :j4$ f:4$i 9p4$R f9@,@3ppPtf@F,>(8(5@@3ppPtf@F>(_M8(t&F@g@3ppPtf@Fg>( 8(@j@3ppPtf@Fj>(8(Jt&t4$|84$fc84$L8Z$/)t`;t[B3D$D$$$S74$<7j$v4$7@8@3ppPtf@F8>(q_8(\fD$ D$D$$R@@3ppPtf@F>(8($RP@3pp6$RP@3pp|644$Y6@@3pp!56*4$6@)@3pp!5q4$`5@@3ppPtf@F>(8(K4$5mB3BpZ5$RP@3pp)5@@3ppPtf@F>(8(4$D44$-44$4D$ D$ D$$@q`,$s<$^4K$ 9QFQ@3pp*"4Jzwdnd$@sV@zq8P|9{Ax4<v 4x<v4xЉ< w_4xt 4q29'x4<4x<4xЉ< 4_9s!< t< t< t < t< t&uۍ~9v >=@8D$$OGN@88039<\4 480488x뺋$V@lt@ u4tSP@=vMPvPvPЀ v<_ZƋ;p|ZB t볉4$BuZ?>8B3Hp,10%wUZG99׍vsw<\B:8#Zۉ $AsYx3th@3Hp,1qz|9s 8t\u\t8u܃YP H(P \X u@3QPp3$ W$U|$D$$KD$$D$Wx8D$D$ $A,D$D$$]@%@=@D$$ ],ljH 48t$D$$J$D$i|$$D$bD$@$D$V8B<4u@ofD$D$4$eu VF t t t t tt& @ u$@lt@ us4udPvPwxt1P|$D$D$'9$O$fP@=w $Ou1<_냉 $^¸fӋ@@3ppPtf@F>(8(4$6&P@=4$RNu1<_4$]¸Ӌ@h@3ppPtf@Fh>(H68(3@@3ppPtf@F>(8(f@@3ppPtf@F>(8(5,4$k%@X@3pp'G%B3BIBpJt8(,8(v@@3ppPtf@F>(8(k@^@3pp!$@c@3pp!p$@]@3pp!L$@\@3pp!($@[@3pp!$@h@3pp!#$RP@3pp#@3pp#@@3ppPtf@F>(q_8(\D$D$$.BB3Bp#{tY't!D$D$$,,tEBB3Bp+"B3Bp+"B빋44$K"@@3ppPtf@F>("8( @*@3ppPtf@F*>(8(b@3pp!D$ D$D$$=4$W!@@3ppPtf@F>(4"8(x4$rf @e@3ppPtf@Fe>(8(U4u2@3ppx 4$a 9tN8{0BB3Bp! @Z@3pp'@@3ppPtf@F>(8(W@@3ppPtf@F>(n8( k@'@3ppPtf@F'>(5#8( B3Bp@w@3ppPtf@Fw>(8(Zt&4$ @&@3ppPtf@F&>(iW8(T@(@3ppPtf@F(>( 8(v4$YD$ D$D$$f9@@3ppPtf@F>(8(~@@3ppPtf@F>(H68(3@@3pp!4$b4$K4$4c4$@3pp6@7@3ppPtf@F7>(bP8(M4$#@n@3ppPtf@Fn>(8(@lt @ 48S8y:v@3@tD$$0D$8D$:<$t$4Xttt$T|$$D84+0ƅ,Dž8$Zƅƅ4\tTD$D$$CfD$ D$D$$2D$ |$D$$17<;ӾD$$dY$VY1M8P@=84$AS 8鱽@U@3pp&@@3pp.4$w4$`@o@3ppPtf@Fo>(7%8("@V@3pp&@z@3ppPtf@Fz>(8(M@|@3ppPtf@F|>(we8(bD$D$$4BB3Bp-4$n@@3ppPtf@F>(8(S4$4$r@k@3ppPtf@Fk>(O=8(t&6r4$ $RP@3pp@l@3ppPtf@Fl>(8(C 4$y4$b~$19NFNB3Bp赾@T@3pp&@@3ppPtf@F>(ѿ8(\鼿@i@3ppPtf@Fi>(t8(q@k@3ppPtf@Fk>(5#8( @5@3ppPtf@F5>(8(uվ?4$(@4$=4$|>4$fc4$KRD$"T$$[8}?4 8tl$#S4_ D$<$W@Q@3ppPtf@FQ>(zh8(e14$;@.@3pp!@/@3ppPtf@F/>(8(yvּ@@3ppPtf@F>(8(+鋼@P@3pp!T@N@3ppPtf@FN>(+8(O4$i@i@3pp!@M@3pp!@K@3ppPtf@FK>({i8(fL4$<@d@3ppPtf@Fd>(8(@e@3ppPtf@Fe>(Ⱥ8(S鳺@f@3pp!|@@3ppPtf@F>(SA8(޹>@V@3pp!U4$mT4$V@`@3ppPtf@F`>(8(;雹@_@3ppPtf@F_>(eS8(P@a@3pp!@S@3pp!R4$[4$D$RP@3pp4$@@3ppPtf@F>(bP8(MD$D$$BB3Bp @6@3ppPtf@F6>(з8([黷4$ 8$D8Ht&UVS]Vq BHHJHthP$H@tPDf#f!4PlR P|PlRP|@3f@^)[^]Ðt&|D$$BRJlA tH B36D$D$$b+F[^]Ívƀt2[^]Ðt&Hl@8PlR P|PxPtPpPlRP|ǀǀD$@l$=@1@ @$@,@HP@B @tƀ @H,&ƀ@@, $ÐUWVS,}To GEG9EO~wU1ȉ։&҉Pt.Q9~AF tPuۉM$HMՍvM$5MQ9Đt&ωыGU)9‰wG_&FtJF tP҉P9wshF;}$!뫍v,[^_]ËtV ;t"\@0@ @@ $5t$P넍$4qvUWVSRin l8wJ|$$RQVEfUĉ+WGBEGH9MrO OMEm؃tz݃/2D$GU$$Qv$1AvSЅ_-wfFGt@F hNFfMOf-l[^_]Ít&MȋlfGEt&3U$?,G U>G,E+GUM}+GMU;,WtGwfNGt@F hFG t G NfMNK-NfM4g؉EFЉ$H$D$*?$HD$F$D$[7D$$D$+$E4D$j6GUF$G$D$>$GD$$D$5D$$D$v+$E4D$5GML$*D$$D$*+EGUFD$$U-EGMEċt@D$ FD$FD$FЉ$EG$'EGMF$'EGUu$/EGMUF$/EGU6$ FD$0$BD$$0D$*EGM$ED$.$BD$$.D$)EGUbD$D$$|EGUx$8EGMXVЋ9vFD$F$}@EGUNM $D$U@$GUMUD$F$D$2EGUD$F$D$#E~ *>)4GMWNMUCEU.$r7EGMVЋ9vFD$F$3?EGU@3$7EGUVFU$R&UT$ D$F$D$dD$F$>EGUAVFU$%FЉMD$$D$P0UM$T$ L$D$ E4GUH$%EGUEMF$N%D$$%EGU\D$FD$D$ D$FD$$D$4.EGMFD$ D$$D$EGUVU$AUD$$T$ D$EGMFD$ D$$D$'EGUcFD$ D$$D$EGM.MUEUD$F$D$=.EGMFD$F$D$.E@3GU~$D$$*D$F$D$-E@3GUJD$F$D$-EGMMGUEGU$?$ EGMED${$|E䋓EGUEMP1t$;EGUKVVЋU$!UT$D$F$D:EGMD$D$FD$D$ D$D$D$$D$F$D$+EGMn`VЋNEċFUM$>UMT$UĉL$D$T$`D$D$$D$ OD$P$D$5+NɉMĉtMP1tU $$D%D$.$EGUD$D$F$EGM}D$D$F$dEGUPD$$#EGM*$9D$$`D$EGUD$F$EGMD$$-#E4GUF$r8D$$D$'D$@$D$dEGMPFЉ$%8D$F$D$~'D$@$D$EGUF$7D$@$D$EGM$7D$$D$EGUUMF$D$D$$‹FU$UD$$T$ D$D$$E!U$T$D$%E@3GMD$D$FЉ$‹FU$wUD$$T$ D$xD$$E U$T$D$z$EGMVMUCD$D$$iD$$D$EGUUMUMUMUM*$.EGMF$.EGUqFD$$8EGMLMU9D$$2D$$D$EGUD$ FD$F$D$EGMFЉ$4$D$+$4D$F$D$"D$$D$u$E4D$"GUKF$ 4$D$0+$4D$$D$ "D$$D$$E4D$o"GMEUUMEMMU~MUkMUXS($K,EGU7F$,,EGMFD$$6EGUD$F$bEGM$D$ $4D$$D$D$$EUD$$T$ D$JEGUVD$FD$FЉ$EGM(FD$D$FЉ$EGUF`PD$$NEGM$1D$@$D$EGUD$F$(EGMofǀD$$EGU8NMU$MU$EGM$0EGU$0EGM$D$EGUVFD$D$FD$FD$FD$D$$D$ D$F$D${D$F$l+EGUVFD$D$FD$FD$FD$D$$D$ D$F$D$D$F$*EGU$EEGUaEML$$D$EGU$D$F$D$FЉ$F*EGMVFU$UT$ D$F$D$D$F$)EGUF$U.D$4$E+D$$4D$MEGM9$EGM$)EGU$EGM$U EGUD$F$EGMF$o-D$2$_*D$$2D$gEGUS$)-D$$aD$1EGM$,D$$`D$EGUUM$,D$$^D$EGMD$FD$F$&"EGUrD$ FD$$D$EGM=D$ FD$$D$EGUD$ FD$$D$EGM$+‹FU$+UT$D$F$CEGU$e+‹FU$U+UD$T$ D$F$WEGMC$+‹FU$ +UD$T$ D$F$ EGU$*‹FU$*UD$T$ D$F$EGM$*‹FU$q*UD$T$ D$F$sEGU_$5*‹FU$%*UD$T$ D$F$'EGM$)‹FU$)UD$T$ D$F$EGUFEčV~=tFVU$)UU$w)UD$ UD$D$$uEGMa$7)‹FU$')UD$T$ D$F$)EGMD$ FD$F$@D$#EGUD$F$D$EGMFD$F$D$EGUF$Y($D$iD$@$D$Q EGM=FЉ$($D$"D$F$D$[D$@$D$ EGUF$'$D$D$F$D$D$@$D$ EGMFЉ$V'$D$fD$@$D$N EGU:F$_‹FU$"D$D$$GUD$$T$ D$E@3GMF$‹FU$}"D$D$$UD$$T$ D$vE@3GMVF${‹FU$K UD$$T$ D$E@3GMF$%‹FЉU$D$D$~$ UD$$T$ D$EGMF$k%‹FU$+D$D$~$UD$$T$ D$DEGU0F$%‹FЉU$UD$$T$ D$EGMF$$D$ FD$$D$E@3GUVD$FU$D$U$T$D$D$@$D$JEGU6Mąt@D$D$D$ F$EGFD$D$FЉ$EGUD$D$F$EGMFD$$D$‹FD$FЉU$D$rU$T$D$D$@$D$EGUFD$$D$‹D$FU$D$U$T$D$D$@$D$EGMD$$D$‹FU$Y"U$T$D$D$@$D$*EGU6FD$$D$VFMU$!U$T$D$M$L$D$'D$@$D$EGMFVD$FU$U$T$D$D$@D$F$EEGUQFD$FU$U$T$D$3D$@D$F$EGMD$F$D$/EGUVUMD$ FD$$D$FEGMD$ FD$D$F$EGUND$ FD$$D$EGMEċt@FD$FD$ FЉD$FD$F$"EGMċfH<HGF$1Ft$bEGUzE@3GMVUMCEM.MUEUUMEMEU@@ iP _b$D$UBUt? :TJ:DJ:H7J:H*Eĉ‹fH<HMG1D$$D$EEċ$o GD$$D$MĉE$5 GD$$yD$EEċ$ GMąt@D$FD$ FD$FЉD$F$zEG;UM(UfGU$JUF tP҉PQ;wwchE=Ft;F tPtr҉Ptt9wwUȋF;}$I믋tV ;t"\@0@ @@ `$t뀉$f댉$^ywW9w@҉Pt"W9s&F tPuމ$މ$ WӉW1QEǀ7$r D$$D$D$D$F$c$&oD$"D$${b$D$UUib$D$UebD$$MBD$$GGD${$q$GUsGMbUWVSY; P$H 98 }t&t*;t"@ u8uG}?8t&9}ċPM8P[^_]Í8[^_]Ë8U빍'UWVSEs: P RH r P~Jt&t-t;t@ 8&uߋ}x4uf[^_]US9 ED$D$$1Q@@u@[] UWVS,U&Ó9 U 9P|,[^_]Í&Ex $ 6U EDH GpRU܋@ <M<8Sv;tKP &t @Ut@D$t$E$m~A9u}$dt$‰D$E$UU؁Jm$ [D$Ɖ$)t$D$U$BF% FED$U T$E$UU P,[^_]Í@tK%t6$‰T$t$E$UU؁Jv$ $ 븐&UWVS<é7 ,u88\R9Q\Rw xu);t!;xt;t;|t xu\@ ,[^_]f6t&9tH$HF\% FR} Ev;Et,;xt$;t;|txu xu0t&$M܋\ &'UWVSLUÃ4 P0z9pxa<ɉHx=B 8t싋;th\;tRHuÉŨ$UyË}B0tPO҉PB0L[^_]뚍t&Ủ$U[t&H4Mԋ@8EЋJ Ip M܋I xƍU؉vt;tH 9&uً MċIMHɉMɉHE܃xEtMċM9H4uMԅMԋIf` D$ǍD$<$@D$E$ED$|$$t$ED$\$Nx4tfH<@4tPt҉Pt)E,[^_]Í$pE,[^_]Ðt&$E,[^_]Ðt&UWVS y+ <z P}}8EP;U}8 E v9}6t;t@ uxu׋}?x9|ϐt&E<[^_]f8>9}{$?9kUu܉ ωUt&90;t;tB uT$UEԃ$T$E90~ŋu܋E8UHU(]* u}P4$Uҋ@uj8yP4$\$$N<$@4$2]u}]f8뒍&'UWVSlEԉUȋ N) @0EċEuąUċB H Mx~wE&}̐t&~>2t;tEԉD$F $UcUuF uM9s;HwM̅|,}ȋP4tXu}|$Mt$D$L$ @8$Et}ȋ@$1l[^_]fl[^_]Ð}̋MuU@EtM@%@=@uEȋB$J<΁!u VUM<@<%u3&uUuȸQUWVS,V E$ $ $ EE\EUD$D$<$1ҁfM܉UD$4$L$|$D$4$D$D$4$LMD$D$4$-MH U؅u-8P,[^_]Ðt&\ME$ D$$EUD$<$T$U؋B% Bv\D$!E$M $Et6$ R$ D$ E5H$8$P$$$$bEu4$ $ $ Et&$UWVS\UFó x0D$D$<$D0D$D$<$*N MЋMP UȋRUԋ@E@4E1MP< @EDU܉UX4$JMA$ME؉Eĉ@;V8v2VP !R)ȉUċMą D$EM׋Mĉ<$L$U׈N$Egߋ08F'N rQ8t:8t/D$D$ D$tD$<$7&@tAp8VPU&D$<$D$6]u}]ÐVPJt͋VX)ʉUO UąҍvtUĉ$T$藭ѐt&D$D$ D$tD$<$G\f<$Mt&'Uuu]S u]1u]Ít&@t$٫PE 4$D$$? D$R$]u]É'UWVSLES EuL1[^_]Í@EtE %EԍvD$u؉4$蝲EtU܋Bx p~]u}]Ð4$ݍڋ@$ ˍ4T$$ U8U]M}} u puK@$L$ D$|$P tq@trHɉJts]u}]ÍD$D$D$D$D$ D$|$4$D몐t&1롍t&$뎐$X{UhE] Eu}8E u1]u}]Ðt&GtU D$D$D$D$D$ D$T$$zt@E܋P UP|1EpGP8tpxtjMD$ $LMMRD$ EԉL$M $REE*UD$$M܃9p~@U9G8}$WMuэ$ EvUE$'USEu UM uQu%fuV D$$/[]ÐD$L$$xu<[]ÉD$L$$h[]fD$$[]Íx롋xD${$D$d$&'UWVS{tZUĉrEEEĺ=M ƋEă@0hČ[^_]Ðt&Pƀ>{u4$YuMċQ:{GEčrpD$}4$UUEg9<)K8MAdEčJHu8dU9P,Ec<.[<}SAt&.t}t DŽu9}wm)ȉEED$ED$ D$ $UEMċQ)9E1UăBЃ;}EČ[^_]ËMĉA|$$)‰D$ @D$T$EċH\}Mċd9A,Uuă%&Mĺ!t ҃#E'dMMM܉MMEUUUUщƍ@uƉUM&EċUM9P,EQ1U ׄt2.t-}t(zt&<.t<}u)Љ}ED$ ED$M$L$PUTMċI)9MGUv4=v+=v"=v=v҃Uw+4$‹EtEƋEUăB9EMċEu9A,MEUăB,EMăAEȃiWML$U$T$E܋Uwk}4t&4$‹EUEƋE9A)…҉U4NjM<$L$jM؅uύt&A9Et&wnEUăB<'At$$)D$ D$L$UUEăP*EăPEĺ$wFQD$D$)щT$ L$$蜙ad9B,tBD$l$gMċqUċBt$)‰D$ xD$T$$MċQUĉBMĺyht  ЋU9CljBM9J,tBD$l$UċBRD$ )D$T$L$$nMUĉJUċd9B,tBD$l$MċQA)D$ D$T$L$$EċHEčPMĸyht  ‹E9UFUPU9P,-MċAD$l$d9A,tAD$l$EċPMċAщT$)D$ D$L$$[vUWVS y ;}r}܉>P\29uwu܉29H@ыuЋU;UvMv9щrE׋UBfBE1҉UEm؃tz݃|zw3U؋ED$T$$(<[^_]H<<[^_]ËD${$-t&JUB(BAAA AAAAP tQ]Í&'UWVփ}tcM1уu n t tN;Ot @߈@t @߈^_]ÍvM1уuiu^1t&TT utPG(F(G)F)G*F*G+F+i^vEu8E!1t&TT uЍt&'U 4$1|$B4$|$]AU E1}׉uBEE tu}]ÍvUWVS,@d?  J΋PG@9G9t,$UD$L$蓱GU0F @)O9w=U G0G҉G4G@ƒ ‰W@EG<G8@WB tu'G g@,[^_]Ít&G@t:t&D$w$Ⱦt@ 뼍vB$͓NdɉGU$谓OUvGU G0G҉G4"G@G4ƒ#ωG@ 4$U}GOU0t&u,G G@ƒt% ‰W@EG(G$vGэvG@ۋO#U8]uƉ}@+ E@ 8U܉$ :M L$MA UuXFx $UGU1FM@ F@ HT$UT$$ݬ]u}]ÍFH ED$AM؉$}M؉AUfU܉D$$VMA U܉UU'UWVSE@, EV$UAd9N,tF8^F,;d$F,t W1 r񍃓dD$ $ENM;NEE1d9N,t:.=EE}]E1ɺNaEEEEE;F8]tzɉUeWft&.vdF0F9F,tF,;dF< UNM;N&UUˆUv}F,;d}%}t ?5$ D$EċEUĉD$$MD$D$ $UċED$$D$ǬMĉ $<{$MzVMR LGČ[^_]Ðt&}:t}.t }=IUăfHvHvHЀ v<_tބ8E z]BU+ND$L$FT$ T$UD$ D$$&U}.}=VU MF,;dF,@vE1ɺNaEEEUUĉUVdVUĉEVFUĉE19UvU[8\g9UVUd9N,nE=F9ʉMZЉ}ĉUu}ĉ‰tMMr uăEL9E}}ċUuE=wNdu F1ɉEE 9dNM1at&Ev=NdUNV,EFM҃"MNNjEGF,UNUB B2$ %&E0&Lƒs%49tҸDE=Ev'M$,V<iD$ ED$F$)ЉD$ǰUEFЉEĉFM:t.t =Eă9EEU:UEFEE;Et V;UUrU9UvEFUz]`UVEĀ8:U:^SEE)Ѓ!FUMuD$)‹EĉL$T$t$ ED$ D$$lt&E1&TEEv@FdUEЃFEEĉƒ0Hd9F,ZEăavEăA@F+VD$T$ FUĉM$D$$T$D$vUMvM$,V<iD$ ED$F$)ЉD$裮EEFM8MD$ dT$D$ $UrF1ɋUEF<F8{WPEVD$}$UM蟑UMEEMD$ $)ЉEE܉EĉD$ED$EEFMU䋃E‹UĉMM}Ed9F,F+VD$T$F$D$ D$UMm1}V,V;d]N1+MMċN9MFU+NL$NL$NT$ T$EL$MT$$L$eE}UM҃UĺMTO V,;d$hFD$l$VF)D$ ]D$T$L$$腺E M#E 2E!FFBT @UEE!ZE ?E U܉M$ MkVUċU$EUEFFUĉT$UMD$ T$$EEEF}Mw UUuFE;FzEE8{d9V,tJF8^E!+}pEUĉD$EMT$UD$ D$$IMEF  "<  O+ !dUԉE9B,EԉMkM‹Eԋ@9ȉE#M;EEԋM9H,quԋFl^D$D$D$D$D$ D$T$$荜 p F&@EЃ}F EUԋJ@19tTűu t&9 tC9űJMȃM9J MȃJMԋQ@MЉ@&EPEt&EEČ[^_]ÍvϋM̀}}:ut$g4$nta)4ƃ13}>t NjMЉL$u4$E%EUЉT$$EթUԋMB;B REy8)A},UEԉP@&}>UЉT$uʉ4$Eo}tq}ԋd9G,tc} UUtRu&<804$@t*FV<uۋEЉD$M $E̍t&EMԋAQ9,8)Mԉ֋dA)9Q,tAD$l$!}ԋG|~ uD$ hD$yT$t$$街flj)uЉ}ȉUgűMԉqP)u&F)u9MfMЉ4$L$UEӧdE9B,t RL+Eк4$D$EԈMuMUԋEE9B,vBLEidEEԋUԋ@@EB@M- $EuԉEE9F,t-FHuUVHMA8 tuAXt&E E&u}uЍEԁH8U̅‰׺Q&14$E0EueUԋd9B,tMB+ẺD$ủ4$ěƍ$ET}GMԋQR tuԁN8E̻EČ[^_]Ã}uЍM̺O8}uЍEԋŰpH‰Mԋd9A,tAD$l$؜uԋVF)T$D$L$}D$|$ D$$Eȅt"}uЍ^w}̺N}NUԋd9B,tBD$l$3MԋQA)D$ T$L$uЉt$ }ȉD$4$|$L=dEԉu9r,M覸UԋMƋB9a8)XU1M9J,t+$EMԅQR ttFuԺCF4t ҃E$E&EE(E}ԾGPO8GM̉)t&{}PDžQ\ùxxЀ~{uԋNNExF<)t$(U fJ<)uEcEUԋd9B,tBD$l$uԋN}ԉʋGL$)‰D$T$ ED$ D$ $~)EԺBLEEδFuԍA1҉FdE9F,MnUԋMƋB9M:MԃAU19Q,t+$EMԅQR ttF$EԺFEEE8) u $EԺ5̞t$$UE EE‰t$$E0E$EԺ7耞t$$ŰE辝EvEt<|E<) EԺ%趞t$$NjŰErUЅt$<$UЋEUUЉt$<$Eԃ@uԃF<$^'EԉM=ME|%}.<$EԉM蕝UԋMEd9B,GB8 =B\ut9zH*BHE1҉Mǝ}ԋMEd9G,EG`t&ǍP:v*yP$t&|uԋE܋U !Љ}:رE UԋBt&uԍPV@ f uԋFۍE9 uԋFŃ UԋB뺋uԋE9F,TuԋF룋uԋE9F,u$MYMUԋBsvEԋE U!ЋUԉE 1EEE:u9 UԉBE uԋF vVEp@‹@BM9J,tBD$l$:uԋF}ԋWD$D)щD$T$ L$$Ɖ:)M/dUԉE9B,o)ω $|$я%E܉D$ D$ED$<$vEH@E@ M q+$EUԅMƋB@ LBU@ T MԋU܋A@ TtGGEh}EԺ;Mԋ}E9y,t4$EԺ9 U T$$UEXvM̋EԉHUԋd9B,tBD$l$蜐uԋN}ԉʋGL$)‰D$ dD$T$$(< D$Eԉ4$@D$frN@!4$EԺ9YE(UԋB@t\AUЉ4$T$EԺ8MJMM̐t&)W}ԋd9G,tGD$l$褏UԋBRD$ )D$T$L$$3vuԋFTFT;~$d908t8$1d9uԃF<u[MЋB<EUUUЉD$L$)‰T$ u D$$t$QMԃdu9A,QAD$l$ل}ԋW}ԋd9G,tGD$l$諄UԋBRD$)T$L$uЉt$ }ȉ|$Uԋd9B,tBD$l$\MԋQA)D$ < D$T$L$${uԋ}9~,tFD$l$ FUԾ<}>JUЉD$L$D։ƍ )ΉD$t$ T$$Uԃd9B,J;BD$l$虃}ԋO}ԋd9G,tGD$l$kUԋBRD$ ) D$T$L$$z1EEE:Er<)UԋMԋBrd)9Q,tAD$l$}ԋG|~ uD$ D$yT$t$$az'UWVSEn }UVEHMUEFdM܅tVE͍UԉuƉU*v‹E<$sUENjE9s$)…҉UtƋM4$L$LUԅ҉EuumMă~MċMMt&<)0<$R<(<#:MN&V< 9wMVN8<\<^X<[z~U襲EF8]MvE~{A<3?*EUEČ[^_]Ít&<+X<.X蹝EMF0|t&EEEtM 닐t&E9F,TUe<<^t<|t&jfMċEFMMLAtU׃}}w uUU9V,U F,t&M趜M+)E*?FdME9F,tR*~JMuBF~$+U9ED$|$Gщ)L$M T$D$L$ A~;~8D$T$$ ufʉgEU<\EM@<߈ElU9V,UavUAwA+VD$T$ FD$M$D$d D$@M5f<$M`MGEGPЀ uUĉE1HЀ f<,uލ$ VXME܉D$E͉D$ $gkE&U<$ӟEd9F,VtFD$l${VFщT$)D$ D$L$$rt&$U^UuVFP K?E&V<H衘Eĺ<$D$+bEiV;Vvt&YF8M 蟃E&M $]MąJ FdV}tE͍UԉuΉEĉU(‹E<$UԋM9s*)хɉMt!UNjMEĉL$$oEUԅ҉Euu^vEE ,΂U$T$U臁dM9N,t NL E+M$L$5U9V,t VL:$fUT$U$"M9N, F0DF0EEą~ U~M ;}U9V,qEċMfAfyvUEEE'M$L$mUF0<,uu<}"}MEąDʉMFUD$ D$$NMUEĀ9,+ N $UMD$ D$VNUMn 90EV處E%V0DF0EUD$$(胣dMt&M$,YtUԋMT$<iD$ F $)ȉD$S`MMԉMElfFP&ȋ<fDE+t&MfAf<Hv E{vEdNdɐM91$V)ʃ Vd } }aQKvy{QG $D$}UMBUMEcE҃ED$ $ЉEԍE؉D$EԉED$l=EvFdUUU}EԋUEԘMԅɉE FdV9F׋U)9V,tFD$l$tF|~ uT$D$ D$y|$$FlME ME ME ME MEAMP @EME}0t6A0<  $MD$ D$JM;F@E؉D$Eԉ $MEED$ ED$eM=Ev U9V,SMԅM}&M}t}{'}DЋF9 8 U19V,t)$ޣF@ |tGCF4t ҃E $3{ME5 ҃{MEt&  ҃`{ME׺TK{MEº6{ME뭋 ҃{ME됺U{MEx ҃zMEXSzME@z{~tB9BljFVU蕣E~nEV1҉$EFPRYzMEN8W=zME %zEN8M zME}yEN8MaFPN8 ҃ yME9FPyMEF9sVNjd)9F,tFD$l$oV|~ uD$T$ t&4yMEFPVyMEyMEtFPN8 ҃ xMEL느t&F<0E&xEt&|xEt&N)уNd</<ΉoB<"<YMF$XwE蕌xEUD$$7藚E$M$L$~UfB"UMT$& $REdF0UEUD$$:EMU$L$ v~;~U:vUUf褋wUT$U$uE4M$L$苙U%vMUL$$u`=d9F,tFD$l$lVFD$)D$ D$ T$L$ $ߎ&F FL:߉Z1MԍE؉$UEED$ ML$D$cUU؉UE@EFdt_UP~d:kMyt&Zfv<,UE;UBFʉL$M$)‰D$  T$D$UUM fz>M9N,CFUM$D$ )L$T$D$$/~dt&9ߍ&ufU9V,tEEFMMAUD$ D$$mAUtF@)NM0< MȃFJЀ v9E1}t}pFd9F,t F ;x8/F4t ҃1<$!sMEnEE EEMD$ D$$@ ~ 9F@)E$D$}Ut6FUtGFoU<$ۍ\dyfC dM9F,V~tFD$l$hVFщT$)D$EĉL$ D$ D$$E9F,tFD$l$hVF)D$ $D$T$L$$3`M9N,tFD$l$VhVF)D$ D$T$L$$_EFM]1Mrd9F,tFD$l$gVF)D$ D$T$L$$}_d9V,tFD$l$gFVD$D$$)щT$ L$/_d9F,tFD$l$OgVFщT$)D$ D$L$$^NU9V,tFD$l$fNFʉL$)‰D$ D$T$$^d9F,tFD$l$fVF)D$ D$T$L$$B^d9F,tFD$l$bfVF)D$ D$T$L$$]FD$l$fVF)D$ DD$T$L$$]d9F,~tFD$l$e~F|$)‰D$ ~D$T$$`]M9N,tFD$l$eFVD$E)щD$ D$dT$L$ $薇d9V,FtFD$l$+eFVD$E)щD$ D$ T$L$ $>&'UWVS\MTf UEEu.d9x,t PLPnE9~,EnE 1ɍUEUăE't&F0Uȉ $MT$lMEϋF;Fs]<|tV<)tREȋUăe$vtXEԋUԅEDщUԋUЉE uU ‹EЉ뜍&tR}u EUЃ Eԃ\[^_]EqEFL8$lE$&muԅEEԉE딐&UWVSd9 $ \E\$,E}`EE<i}"E}#wEQ$EwD$<$`/E@(}x8U}`B@ |D$$/GUzdTD$$U)E@ uD$$ &\9uUxM 9Mu}EEuEU@EEGz$d uEt/MQEɉMуeMUEEEE9ƉE6E܉Et&EH M؅zEMD$ED$ L$ $JU)UUEE=E UED$D$$D$ 0D$D$nN:HIEEu9uJURdEEGf8W$fW$fUtU܋E GPfHUBd$JH E܉DD$M $D$:D+E AJD ET$$\U}*M܉ȉʃGUMMt!EM ȃGMQdE܍P?GHEEu9uEM9M E9G, G,M $\9E E}uED$$),UJ$BEfM@ : PEǃ9+ 4$D$+}G D$$HF G @ fG @ @E 9EyUEDžlDžtUEfEMu|FEy$9ƉuEEܿEEEvUrdJMU؅|uEMD$D$ 4$L$ GU)UE։uE=EUD$D$D$ D$D$$J@ pfM}y Gt&f921t89}H9rW P1҉EUm݃E}x L$G$HGUMB Df4Ћu}MF D8LF ʃD8fEMuuEE9ESUU|MB 4<$YNjEPt EM fE;}sDUBM+xfHtlEtɉtfHUB  &p2fuuf2u4$Y9E E.}EG4ED$G $&&G UD$$p(G}}EEEuuW BpUfu~?} ;Uf9rf9B;U~f}}֋MUUU+U;UMO$U|ʋM)f9uUu6Of w$I)wE ƋOutG MD1t09}U+UUu$RUW EBUE9UMMMED$D$ 4$L$ 2CU؉T$UщT$DE܉$IM؋DMEK====Ev уMM+M=Mعv уʋE܉UvH]G$fG$D$$E@d$OCH E܉DD$M $D$y3D+E AJD ET$$NE&ED$EE$GVU$D$MgvMMعV ȃED$EE$UU$D$bM5=RGHEMMع@ 80MEE܋uV4Bf?E܉D$p $ORbMEuD$D$ L$ 4$u@U؉T$t$E܉$GU؃Evc==X==v у)=Uغv ҃֋E܉uvUغD$$KLED$$?G}UG DfG D@G D%Uغy$ OE ED$ 4$D$ ED$o?EEUD$ D$ ED$$F?E8D$0PDMMعmUغU9W0RW0JG,>}MUG f MMعUغ|uw,w0EEu9uWUU:UMph4M9Fƃ;UUrph@ Mu΋GUTG MuUDUdeED$G$+GMMU1ɉMĉUm݃UD$ЉT$$$G UDxuEEEph|+UUMU@ GUT0G MUuDUMD$ $QI1M41UuD$$ MAMquD$F$FE\9Ug E +EufF}G(}$MyA0M tEttt{E+xxfF`~EPtl)fMQ(A f<uytt+x' xF=gxM}`A@ | }tUBt+Bu~[^_]ËM $֋E+xxfGUB0ED$$MA UD$B$ǃ$MA4$D$uN$F E 9E~}uUuuM܍}DžlUDžtfDž|M}EUhhBEy$9ljEkEEEEEfE&M؅UMED$ $L$ D$9U)UUEE=UMD$D$D$ D$T$ $=@ 8@&fHMFu!UEF@F$‰UFȃE}9}UURdEE܋VB농UED$ <$T$D$ 8UMT$L$E܉$Q?U؃Ev\=vw===v у)=Uغv ҃UE܉UUغD$$DUغÍBN$1EF M<ȋh$"LEVt |EUf|9UvHFU+x|fHtlMEtt3fF S&x:fu|f M $uK9E EuN$E1ҋ}|EG4}QȋMEEEUEAP҉U@A$uUEEuyU4t`}m}uQ uE+ED2EyEUEtq$1u7A}|0EuEA$E;E}iyu7eEE1뤋MED$ <$L$ D$5EUغQU9UvHuUu<t<4u7uu}utu9UUwUQ }+EED:Uy1҅tq$1Pu7A}|0EE9ECEE|9EtAA$EF |}fUغo1EEUBED$B $MA A}<$HlSED$$+MAE$uHlED$$F\ED$$F }E xxgVDžlDžt~(c$a-DxF>uAUB$!MAx}EE}uuF49EEF PUf8EF$E1 9} :9w);Ns~|;}u؃E}ET$DD$$.D@ .@ E}M}EȃF}t&M} ȃFF$U*}UED$$D$B.B t[RU؋@ }taxxU؈U؍J҉MtU M؃yɉ}uUEaMD$$L$XHgxQ1}}닉DD$"D$$HDE}}CxxBfAuF,~()F,F0)F0Lx~1E tEtfmMEtfEt}M}DD$L$<$,D@ @ 8ɉMNM}}tR} ȃFEȃFuF0}ȃFF$DD$"D$$lFD0M y4WUD${$=MA4D$A $uF D$$FDžtDžlEEgE܉D$< $5=Ec&UWVSF9b ,c$Vtb$1H?|UD$ $t#D>uڋ,[^_]ËED>ލ&|PPP PP'UWVSMU Eu}eE1E?a E DžUtO@FDž<-=u$u*<-u&x-u $AuUO,DžDžDžDžDžDžDžDžt 9JwxBruJ J Mxt<!++ɀ zrЉf7uKPtD;}:։$@t,Hр<$uPt;|͍&EPpE@<8<<5UJ5E sE S|U$MEDžDž&;Me O@tO@hGDE %΃9MEP9CDždWDhWHl$({= EPUtEE %1‹ E L$E‹ D$Et$ $T$D$$D$ ED$M9ƋOƁDE Edf1^vU$lV@9u8Q Eu /fp&rЉt&'mpBl&EE t"7)G9W)E E t!GLU>Ce &xUU e x 9A E@My%u#ȍt&$x5x%tu9U$Dž Dž1Ƀ1ƅDž$~G8<$ tX!s$D$|$L$ t$|$B1҉Dž <!D<9!DȈ4$4;E ҈FBx$V  ʈx!tE Džs$}M U E1ɉƅDžDžDžDžXЃ1A(WL rWLD2GL GLu~#GLEuW‰W1Pv ~$=uwLL=uju>u E qΉ<Dž|DždGDhGHl1E (t%f82uuIKEpʀ E $EʉEUEE$t$L$D$Et$D$$D$ ED$$‹E8tu6t,d%tO@hGD]E  WL$U<8E<$EHD[t&8n<`ED4$EL$}D$Nj84$^$Dž(1҃$dDž <DžDžDžDžDžDž,Dž0Dž4Dž@DžDDžHD$wWDžUe34l[^_]Ë$~ t Љ Dž :$(8D$88AAA ADO@GE G$E (4E <$   0Ј,0EL4AD$@‹HODO@Gz% ȋ(A(B?40M D440mtfuu逽 4t4-0y:EO $D$D$U(*W DG\ ЈG\EȀ,t )@D@<DB8 1҉TP߭P݃|zlݝݝ $D$ D$,$1҉TP߭P݅݅D$ $D$0$\8QD(M $88DD(DžDžA\ ЉA\;dLH1ҋ2':Dž$:t?ʉ$ ( $@< $ 4u4$uV-eDž$-DžLBpz Džt&'u,DžH뜍&Dž$xp҉$]f~Q$4 Df҉T$$S) V< $ <  <B iLt&V€<O$ tD ȃO<G$EuV8.|$ t$T$$Z]u}]Ðt&US4 tb$j@ t\RU@ D$D$D$D$ T$$Yt@ t5@4[]f41[]ÍUT$D$"$U듍t&D$$4[]Ív'UWVSL4 &DE4$EЉEȉE|@ fRUx T$D$D$D$ |$$e%F%==UЋ$D$D$ $|$D$ED$$FmuԉƉ4$@ 4UT$D$"$MUv==\-ND$GD$D$ $|$D$ED$$HSL[^_]à )vt&t1uUԅ tĉt&FTEԅt UA&=vt֍=t&f붍=v=t&4!D$$D$D$ $|$D$ED$$%F(#=t=t&vŰ$D$D$ $|$D$ED$$F1F )F$!$ vUu t&t f@t&th&UWVSEU Í uE%123EEleU1Һ"E4567TEE89ABECDFEf%f7%ExEDЋEXxEEElEUE@E)EE9lElLvtH~,SE1pt&}nEwE u2X9x9J^t&v}t 89MrZUĉT$UD$DD$ $DEuu9uv;}FS9TtT+l2UB Ue3[^_]Í& _Y"-f &9u&vM 0 ,D$xD$LED$4$=|EtVD$pDD$ D$D$ED$ $WDl$ID$xD$tD$EĈDD$ D$D$ $D띍t&҉D$ET$$葨7t& &Evvlt$$UEЈU|D$ED$$軺%t \Hx9SxEŸG& Et)ErEn X"E"fEfl?D$xD$HbxT &UWVSL} 6ã E"@"CtD$E$7@D$ED$ED$ UT$E D$E$GUtUT$E$" tE;EwUB L[^_]Ít&D$D$ D$U$UB L[^_]Ðt&|D$T$U$E谸EԀ"D$ D$HfޕD$ D$D$U$c7D$ וD$T$U$E0ED$ D$D$E$U8E]Fó uu}}D$ E D$D$D$t$D$<$;us E <0tG ]u}]ÍD$ D$D$<$f̍U] uu |D$ HE4$D$D$!E4$D$ED$]u]Í&UES$EED$ E+Ø D$E D$E$$[]fU8]Ec uu}} D$ t$D$E|$$ԘtxD$<$^t1@ t+@ I DtD$D$<$'B<$D$D$ ]u}]Ít&D$ <$hݍ&'U8]Eà uu}} D$ t$D$E|$$t0@<$D$D$r]u}]Ðt&D$ <$Н܍U8]E uu}} D$ t$D$E|$$dt@F t:P F Dt*D$D$<$љ]u}]Ít&D$ <$0ݍUWVSY ,}輷T$$sD$ D$|$4$V UU$T$ T$D$苖G @ 9tBD$4$D$ D$v mT$$t$ D$?JD$ $J5#"T$$D$ ,[^_]Ít&'UWVSI \u謶D$Ǎ|EȉD$<$MUUUUNUE;4;8;xt;|hFEL~x:E94 BỦ}̍:9y}1҃}ҍƯDEȉD$ Eԉ<$D$D$负ND$<$UP v UUUUt NUEЃT$<$E蛫EčfUԋUЅt"uЉƍvEԃ<$D$nuuЋ08t FG G \[^_]Ð;;xD$<$F% =>gD$<$N C  <$D$M詪MąF@^~ kD$Uȉ$<$%D$U^UF tXF @Eu F @ED$D$D$ F $D$U覶<$D$ D$谝UċD$H L$ @D$F $D$Uc<$D$D$mUF CBB$װEЃt&%D$<$fENYf}̃}=D$<$,N#t&D$<$FЩfxV :1EЃf<$D$D$\[^_]Íkt&D$<$nB_ЩfRHE5/EЉփD$<$ EЃhUЃPW @D$<$٧̋EЃ1T$<$E躧E4$T'D$<$萧=Uȋ@(tPD$T$<$EЃEEc tT8$;dtf@ tkD$\$<$蛚ֻEЃC@D$!D$<$_4u\$D$<$5$XEЃD$ k@$t$D$o<$D$D$U@D$b{v'UWVS ,$P;UBf%f=mD${$MA%  |EPpȃDRɉ΃ 'MyAEp 9T$t$$`fT$$I,1[^_]Í&uʋUB$ t$T$$띐t&qǃ0!΃,GHD$D$@0$MD$Q T$$@  p YvOJf뇋MI$螲UD$ D$ƋB4$D$zF t\~ ||$T$$FF}4$Ūp=FvbfvD$"D$4$닍t&LJ7$8YvD$"D$$X74$ȋvb螿2T$$ UWVSLù f}|$UD$ zD$$荈~ F}~yf}f}aU"D$|$$8F<$D$~D$貊Ft/vt(}}t&Ut$<$T$vu}M#"|$D$ $‡L[^_]fTD$<$FVffmU4$Tt&f}fvff}tjRf}t&Yf}t&uLF$˘D$ !D$E|$$Ft&f}F@Ff}!vf}t&ff}t&uFN $蛬E3ED$$@UD$ D$F$D$^MA ;A UD$ !D$|$$1FvMT$ D$|$ $FED$$SFI+D$ $MVM¨@P  FfE؋RtA UD$ %D$Mԉ|$$ MԋAA $茣&MD$ $MEEE܋$UDtSF%F t ~M؋@U؋B#B$f}ft f}UF@t- D$E؉$널t&f}f}f}vf}vf}t&f}t&f}t&fuvFVt6B t0H B Dt D$ D$E|$$pD$D$F,$D$D$F,$U|$$D$ D$Lf}f}f}%xf}$t&f}#t&Kf}=t&f}f}txf}Ef}U܄V¨  ҍv ¨@}vqU؍ D$$UWtD$<$螄4U!D$|$$F2(<$D$~D$ZM!D$|$ $衁F <$D$~D$!D$E|$$bF$*tD$<$F.f} 7Mt$|$ $=Ft&f}Ff}HvA |$D$ !D$E$̀/ $MԉD$MYv D$ $MӗFM-& D$ $M諗FM& $MԉD$胗VM&D$ $M[VMt&D$ $M3VM\t&D$ $M VM,t&D$ $MVMt& $vM؉ $}Ef-fLFFt<@ t6@ R Dt&MD$ D$|$ $~D$D$F,$蝎D$D$F,$zD$ zEf-fCM؍" D$ $迕 $MԉD$襕MF |$D$ "D$E$=~>UD$ D$|$$~ED$"D$$蛹MD$ D$|$ $}'U؍!D$$tD$<$H(tD$<$1M!D$|$ $s}F\F@U؍9 D$$苔F@M؍A D$ $gif}~f}f f}f}f}t&t f}EFƒ`@{`T uU؍ D$$FV D$E؉$F8FU @U؍s D$$rtva D$E؉$EGf}Ef}EF@"M؍z D$ $h D$E؉$FTM؍\ D$ $ΒF.L D$E؉$谒F D$E؉$蒒FM؍ D$ $tFM؍ D$ $VFU؍T D$$8Ff}f}f}f}f}t&f}t&Lf}t&f}t&f}t&tf}t&t f}V¨tU؍e!D$$zV¨ tM؍m!D$ $ZV¨@tv!D$E؉$:V5U؍!D$$M؍ D$ $VYU؍ D$$V0U؍ D$$F0M؍ D$ $袐F D$E؉$脐V D$E؉$cVV¨@tU؍ D$$:V¨tM؍ D$ $V¨ t D$E؉$VyU؍!D$$ݏVM؍ !D$ $軏f} f}t&M܋9Fff%fF~_!D$E؉$CEFtU؍J!D$$!FtM؍S!D$ $F\!D$E؉$F@>!D$E؉$迎F@M؍7!D$ $蛎F@U؍.!D$$wyF o$!D$E؉$SU~KM؍!D$ $/1F@'U؍!D$$ F@!D$E؉$M؍!D$ $͍FdF@U؍!D$$襍FyM؍!D$ $胍F@~!D$E؉$bdt&USk U$T$D$[]ÍUWVS輲) g@Ht x  D$ *D$M L$}<$s}@LP^[ D$ *D$E D$U$fU@MD$ )D$M L$}<$ffFtCF3[^_]É|$ D$$D$U $iFu4$vf[^_]ÍvH/&#D$4$^}{#D$4$F}u#D$4$.}Wk#D$4$}/$#D$4$|`*#D$4$| R2#D$4$|@D7#D$4$|6<#D$4$|(v#D$4$h||#D$4$J| #D$4$,|%A#D$4$|UB%=F#D$4${fd#D$4${Z#D$4${T#D$4${O#D$4$~{fHV @j MQ>t&MQ< }G%EP x@ EE%T$ D$E D$U$~cMA UM L$P T$ @D$}G 4$D$D${D$E $eG 2fD$M $e}@D$ ,%D$E D$U$b@ D$ 9%D$M L$}<$b l/M@<G~ V@t&Z1MAZ}@<J#D$4$Oy3fMA @L!$D$4$x}WщЁ@@i$D$4$xY}G@@@@ @@$D$4$LxMA}GƋEP%=>U@D$ $D$M L$E$`D$ U $fv}D$4$w4$~[^_]Ðt&Zx$D$4$hwCv#D$4$Nw#D$4$6woЃ t&#D$4$w8 $;d@ }$\$D$ D$E D$U$R_}WKt&#D$U T$M $$_[^_]Ð}G D$ $D$E D$U$^M9M} |$L$D$ED$ UB D$M L$E$WsfMA @D$ $D$} |$E$o^U@|$D$ $D$M $J^}WE&n6MPt;} |$D$ED$MT$L$ } |$E$U@D$ [%D$M L$}<$,w4M$\$D$ D$} |$E$i]dt&BEOD$ %D$U T$M $1]}W }Wt&EP t&ƒ t&MA%@=@PP%T$ D$} |$E$%vUv% fU@D$ $UB t,B D$@D$ E'D$M L$}<$4\U@D$ ['D$M L$}<$uU@=P t8GD$M@ D$ h'D$} |$E$[U@$D$ 'D$M L$}<$[UP$t J@(D$ 'D$M L$}<$bU@,D$ )D$M <$L$:[ A}@U}G @ D$ p)D$E D$U$UG @$D$ )D$M L$}<$TUB P(1JED$ )D$M <$L$T}@D$ )D$E D$U$TG @ D$ )D$M L$}<$1at&UB D$ c%D$M L$}<$BTEH 1zRt U$w9MxDžxt $v%D$U $qV1Dž1UMI 1v1ɋ1҅t&uNʃ9L񋍜;y v%1ɽ|tMED$|$T$ L$E $WU9tT$M $>U9}|D$)} <$XQ& ۅu⋅+t t&uE1JRt#U$ݝhxtx݅h)1҉ۅأ/߭D$ M $ݝhݝHݝXW%݅H݅X݅hD$؋/\$ } |$E$SQD$ U $`WM1zRt $'t)Ǎ&|$ D$U T$M $Q}@D$ %D$E D$U$P@ D$ %D$M L$}<$PUB tыP A DD$ &D$} |$E$|PU1B tыP A D D$ +&D$} |$E$CPD$:U$ {t$@tD$ <&D$|$M $P}G P G Dt-D$ N&D$E D$U$OG M $}ҋH G |th]&T$ D$E D$M $xxOE D$D$ML$ED$ xT$E D$E$cGD$PT$@D$ q&D$U T$M $NG D$ &D$E D$U$NGD$ &D$M L$E$Nt^D$ &D$U T$M $NE D$D$UT$ED$ D$M L$E$cGt_D$ &D$E D$U$+NM L$D$ED$ED$ GD$U T$E$bGt_D$ &D$M L$E$MU T$D$ML$ED$ GD$E D$E$6bGt_D$ 'D$U T$M $_ME D$D$UT$ED$ GD$M L$E$a}9}lE@ tMP A D L}+}E-'$wK' '7'|f@EW t$M $xuE D$ D$ED$xT$$pMD$ D$U $T$#LG bFPD 7|$D$U $NM L$D$}|$ED$ D$U T$ $P`D$}<$}QF4$Bp@ ED$"D$<$߆#D$4$fb}@<#D$4$FbM@<#D$4$&bU@;,;l+; +;+;+;.r;\+;"+;%+;(+;-+t|;5+tn;0>+t`;LE+tR;GtD;,}t6;P+t(;,Y+t;t D$ ,T$ c+D$M EL$$8>FfSv~ uzfHM׉8Mcu|$ +D$UE $D$=F <Ft4D$ ;,UD$E $D$=~ rF YF nFD$ o,UD$E $D$C=F `~ wtz|D$$vM D$ L$NjF D$F<$D$`D${D$E $|?t GOG&E D$ $B~ w61L[^_]ÐT$ +M D$ +D$EL$$U<~ eF *J~ gyF nU +,MD$T$ $5&D$$O@ t&U(]E bÃ} u}}$P@t'G9CE |$D$E$z?E8]u}]ÍU8]Ea} u}}$?M $?t8G9s1)M 9GCE|$UL$$>}7U2]u}]Í'U]EaÃ| u$,t $H?U ]u] UVS`:| D$V5$'t2ED$D$4$4tE4$-GEuKu4$ieD$5E@iECBE"ui[ i ֍ [^]ÍUSE`u{ D$ ED$E D$E$F+[]Ð&U8uu]}_-{ Ftv F< t1]u}]fD$D$D$ D$|$4$KtD$D$D$ D$D$ |$D$4$W@ px ft&UH]^cz eE1}}u08uJD$4$1] 'U8]^Æy }}uu<$E<$8(t@PVPVP V PVPVPVPVP V P$V$@(F(]u}] US]x $ 0[]ÍUWVS,}V]x M E}NEuEE1~f9uEE9Eu܋MEE9ȉE|4}fUT$E4$D$UZ:U9}}؉}9M),[^_]ËED$D$E$+,[^_]ËE)ȉωL$E4$D$:,[^_]1`'U(E]6\ãw uu ]u]ÐU$T$U T$=y8u͋u빍E,EvUSE [%w D$D$E$ 4[]Í&'US~[v lD$ED$$3¸ElĤ[]Ít&U]` [Ív uu }}$\!DEtEu uME<$D$\D$13]u}]ÍUWVSZ v u4$AD$D$$>Dž4zrB}B4$y7$XNj( T$D$$`J,D$D$$Ut#0t$|$$*]u}]fT$D$$LfU1(uu]!MÎh }t#4$]+x<$B>|$t$$*]u}]Í'UWVS\UL3h LM 1„uXU R U܋NMUԋUMMR }}U؋MJ+M+M9|!9}JL9}<u~ 1\[^_]ÍvM 1VofuuUԉuu܉UЋU+U9uԉUuELMuvty9E~tM;UuU9UvuЈM8MyH}ЉM̋u̍J9E8ML[^_]ÍE@EЉD$ }Љ|$E $D$UUu}tE M)Ѝp:uFT$L$$ D뀍ED$"D$4$M6GMUEЋE )97v 1L[^_]Í&M A< 9u8Q0σMЍp üM׋uM8u}ЍJp9}81눐V…uu69M v}8twu f8tl9wҋ} z1:vE U x )W&} ϋM :Q81r9uu: $D$t$M M}8} 8W<vvx}̈Mf9vG&9v2:u:Wvt98WvbАt&}ЋEЍ|9M }̉UȉEvUtJ9M w;M @Eȋu؍<Eĉt$<$D$ vEȉϋUĉMЅ: tMЃ9M v뉍t&UWVS\E E#a uEt7F t IfD$ D$D$4$F% =ED$BD$4$%EF<% @FE={EEED$4$4UiEV EJMMet1MЈ ;Er}}9}r8uЃЉUu9tHM:uU(ƒ9uuD$D$ D$BD$4$BU~ Et=1uЉUfEԃ;Es9r;EruЋU PMԋP@d}̅tN\[^_]Ít&@EQvEEljU)UD$4$ 3t&D$ 4$@"FD$w4$81D$ D$4$ǍfD$W W zE%fm"&'USB+^ E$[]Í'USEB] t$w[]É'UWVS\B] \uH;tLtv$98u[^_]Í[^_]$3fUSE A5] Ut,tD$$ t([]f$2$81܍t&,:u&UWVS\A\ EE$C=E EEEEEċEEȋEE̋E EЋE$EԋE(E؋E,E܋E$2EEEEEĉEEȉEẺEEЉEEԉEE؉EE܉EEEEEE$EEEE$@1NjED$ ED$@<$D$]7?u E8ftvE$p@4$|1|tNkdU9u|c<$t$*t'ED$ Et$<$D$69}Ʌ~Őt&Č[^_]ÍvdČ[^_]Ív<$17Č[^_]É'UWVS? [ L\0\E$EU܋:E1EML$E<$D$3u U<=tE܃ u؉M6E$#U $MNj7B$UȉM/MĉMt$M$L$M0=M4|$E 4$D$UȋMDL[^_]ÍvU tyU$fM $Y 8A$MĉU3/|$ƋE4$D$~D>>=UȉT$U $T$`MD4$"L[^_]ËE$mv MЋ OEЋEЉuԉuЋUЍv8уuuԋUԉMЋu$|.EE1u̐$mp4$R.U䋋t$$T$;}|űUEЋ $D$)'M؉DE1EyUM܋$3:N<fN8 u$e-E܉E1u&USE ;eW D$E$[]ÍUM ];3W uutO1Ҹ9rBuL$$Vt]u]ÉL$4$<f,:uD${$1&U(]9;æV u}8t7t7]u}]Í|D$D$$7ύ$,D$$"FF F@7댍t&'UWVS:U L}4<$U D$D$D$T$ |$D$4$ @t V | t_$PDPuTt x 8us*~D$ D$D$4$qL[^_]Í&@@ @ D$i5T$ D$4$r5D$ D$D$4$fP ORDz:R-4 MԋIMtlfEtEunMԋ9tqxM䋻|;tH}䍃y5T$L$D$|$ 4$1Mԋy fGuv럋Mԋ9tf늋}ԋO }9 w{UE ]V8S uD$E$/Ƌt-u4$]u]Í&UE S7hS $EED$E$^$[]UWVS79S Uu|9$@(t{tv@ʍL σ|8ri΍L σ|8rPσ|8r0TуDrE t$$[^_]ËE t$$ Ƌt 1҉4$"v'UES$EED$E 6R D$E$'/$[]É'UWVSLEv6Q } ut x uN1҃E"EE5E E܋MUЉ $1UЄ|M|x 8 }[Гt :U܉L$M؉D$ẺT$5T$UL$ $JÈ}tJ$tBM@L[^_]Ë5EM܀xL  &{E؍<J *&5(t&P NR DЋRzU$0UЄGy|@Dt :D$3D$$6 yLst&cvD$3M؉D$EL$ $vL$M܉T$D$ẺL$M؉UЉL$ 5L$M $È}Uq$vAM@lT$MU؉D$3D$ $T$ pCvD$ p3T$D$$J'U(]i3N uu4$6/tEEED$E 4$D$+]u]Ít&U(]3ÆN uu4$tEEED$E 4$D$v+]u]Ít&U(]u121N }t#T$$t Iu'Ƌ8t 1҉]u}]ÐD$$D$$Ƌ@뮍t&'US.2ÛM U EC$t&'UE S1hM $EED$E$.U(E]13M uu D$ED$ D$t$D$E$1x9s ]u]Åt4$'t&U(ED$E]O1üL uu D$ED$ D$t$$x9s ]u]Åt@4$='t&US0[L 45$xu1f t t t t tt 0 "$?}݃E fEm}mEt؋4[]]}EE fEm}mEuǍd4$_&&D$ D$$04[]É'U_WVS}/>K 7taJ0 w{D$ D$4$JЀ wJЀ v t t 7[^_]À &t΍J.wɋ0ۍvӍvˍvt&뾍t&뮍@t&랍t&뎍t&{vt&kv t&[4T$$$ @ҍ4T$$$t&'UWVS\}V.I u G t F tv <$D4$4T$<$D$D$D$ D$D$ D$U7&׆@ EL$<$D$D$D$ D$MED$D$D$ D$D$ Uȉ4$D$T$%x D$D$D$ D$Mĉ4$L$DEЋE$&E܉<$U9N1҉E؉UsD$t$E$@ pD$t$U$@ED$t$<$@ D$t$<$@9E1U9U9u}䍴&5t$D$<$4@uV9u|QD$t$<$@ ut$D$<$D$$ t\[^_]ø6D$t$<$D$$t&D$t$E$iD$$E&9u&D$t$<$$@ t4D$t$<$Pt?\[^_]ÍvD$t$<$D$$u9uu19EE1t9Et1 E̋MЅ…tuҸ̃9u5U9U묍5$O &UWVSD$D$ D$Mԉ $Eԍe[^_]Í5$6M(vU8uu]}!= F tv 4$6D$D$D$ D$|$4$ tlD$D$D$ D$D$ |$D$4$@ u]u}]Ðt&$䍶D$D$D$ D$D$4$ t 4$"랉4$딍5$UWVS ; EEEEEE$ EED$E $D$ E$UJ U< t< t< t< t< tED$E؉D$E܉D$EԉD$ EUUD$D$$EEU:u֍ EԄE}ԉu E؃0UuPЀ w&PЀ vPA<(64MĉEU9Usu }XU1EuU t&<9E0U1+UЃ0ΉM1MЋM)MЉ;U~E$D$EȹE뜍t&Ef}E9ED$$UD$D$$D$$D$ D$6D$D$[$/ M $D$E$UMD$D$$D$D$ D$T$D$ $E8uu!ƍ ƒ8EEEEČ[^_]ËEU+E$D$}tG}uAM9vt8$ED$D$T$ D$D$!ED$6D$ED$D$$D$D$ D$$u $M $D$}<.<_<,PЀ u}ԉu@PЀ 1 /<_HЀ v<_t0< vf0< vu냐t&VUF0<  }ԉuEVE$)ƅ<}$<$D$}D6D$$UD$D$$D$$D$ D$6D$D$$TMD$D$$D$D$ D$D$J6D$ $3NMF0< u>9F1EdEEu19_9Mvf1gfffmЋEЃ0u)‰UЉ1)lj1)9~UD$$T$ME뉐uIE}ԉE{$$UD$D$$D$D$ D$D$׆D$$ $D$D$$D$D$ D$D$D$E$<_t&#v$t&kD$D$$D$D$ D$D$6D$E$J}yM9v?M4$U$D$ D${$UWVSEU 3 EUUeE1B*D$$;UNjO6D$E\$D$ @D$D$@E$. ?I|$$UF 0u uU.EljD$$EUD$4$T$8tD$ 4t$D$$ 4$EUe3Č[^_]É$2UBvu&tVU@EB $E]ED$V$t:P T$@$*Ƹ(ED$ED$$d뜋UB끍l$ 近 UWVS|1 D$EЉ$KǃvԋEЋuĉ$UD؉$QMMĉǐD$Eĉ4$D$qu?tߋE1CvEЉ$-Eԉ$"EЋuĉ$yU T$MD؉$\[^_]ËEЉ$D$D$Eԉ$MD$MDEԉ$6D$<$6$$D$6$ED$EԉD$U$$JfUWVSl# \$E8wEE08E؉$EЉ$05E08 J|$$ r$v|̉f$fEąMD؋MT9R$BMD؉D$D$$8p}ċ0IU1uĉ֐)D$>D$EЉ$sǃvԋEЋuĉ$UD؉$yǍE}ĉǍ&D$|$4$uMă9tߋE}ĉ1.vUD؉$IMD؉$:Uą1\[^_]Ðt&;6D$6$$D$ UD؉$MUD؉DfEЋuĉ$ED$UD؉$<\[^_]Ít&Eԉ$ EЉ$uEԉ$j16D$<$;}t&EЉ$=D$D$Eԉ$EMT19r9tw$D$ UD؉$UM:rD9t$EĉD$EԉD$ UE $DD$ЃD$$MD벍6$US+ E $EEU$t&UE S $EED$E$^$[]U8]Y u}}<$U |$4$D$D$D$D$T$ F ]u}]Ðt&UE SX $EED$E$n$[]UWVuF%EF@u `fNMPυt8 t@ u } ~JtB@~R t*~u`u ~^_]Ív~ڍv~vU1UM u ]Í&@u 쐍t&tP 9u]Ð&UVSJ (tT@tMU rt @8[^]f0VD҉x NPv9tyuՃyɍ&[^]Í&UE @ttML$@$1Í&蕭 U勁T1]Ðt&US{ 8t 1[]ÍvE @D$#$t@1[]  U勁`8tE @ t 1]Ð UE :u ` 1]Ít&H 1]UUE @ Bt B1]Ívȃ wvUE @tPtML$@$1ÍU8]F uu}0>tlWvEIt<~ ufVto WW t!сMtp!ыU щOfhN; u  + ]u}]Ít&WVuE<$5WE널t&U] v udF,t$F,]1u]ÐU]6 u4d|D$E @D$F,$]F,u1]É'UVSE g P tRD$T$@$d4 UD$F,T$$F,1[^]Í&@t&'UWVST hdt&Et닅d$赿dt$$cdD$$D$|4$D$D$dD$$D$@EkĬ[^_]Ít&UWVSi EEd ?Dh8<@T;}E 9sM`;~MU E t G}@ t x t t(UT$UD$ T$$P$\M4 FM@0|@ @@B4D+4QR D I D I 4 | ;4P+D44pE0DL$D$$0<$D$ I|@< +QR  I  Ip|B $8pA Džc?G 7tY@CD $轻}D|$$hDD$$T$$Et h)t /um@ttFFt@t Ut$$ЋFtV gtN ~$농$蘴뜍@E`1[^_]Ív$ivPt!҉P+$$0 vUSEU @ t%@ D$D$$[]Ít&D$"D$$PčUSE U@ DžMMAtFF\1[^_]ËMt싵8D$$t$y\1[^_]Ít&<f% =M@Eq 88uD$: $ɚw+UB&֍7t$;|E}pUB1҉4ȃ %)F@ RU@ t& $ZfF& 7} v\t#HɉH\8jD$$vUD$"T$$1"D$$b$r\1[^_]Ðt&4$Ȯ\1[^_]Ív4$D$4fuN fAED$D$E$&up7$L$t&ED$$8HMAf$J\8t&|9$y\D$'4$.e|D$D$D$ D$D$E$苗%&U]Iö uu $t$~F D$E$;]u]É'U8uu ]}}Z Fu~ tRF$ߏfF~* t9D$L$<$譪]1u}]ÍF@ tO@ fU$ݠUtUUD$<$D$XUG<g떍vD$"D$$넍t&&8D$D$D$ D$D$G,$D$4$D$_ fUXE ]u}@* 8~PHw|08捶 ֍ēuOd@(  / uD$T$4$UB%_DBv]1u}]Ð֍ uߋ(rD$ D$$<MRL$D$4$R딍t&(`@UMRL$D$$RVN ֍t ֍"(@MRL$D$$R uD$4$at&(t@t QDhD$D$E$ˢpD$D$E$衢\t&J A@< D$E$薒!@ @ U@M$D$fx @ @@D$E$4&U$D$D$$-1҉UEm؃tz݃|z $該<$ƉD$E~-_81EԐUԋMD$T$ $,;}|߉4$uN@ @u@(4$D$FH QR4MT$ $y`hMD$ $ Tt&$1B D$E$轂(UD$$衂 t&@ @U@,$D$n|M $D$Q;t&\ovc8ƋE}E܉$\$:|DUD$$ۏMA@tDA>uFtJ6x Vҍ t,t&A< t< t< ft< t < uu؉VUBM"At&֍ ֍S ֍UD$$)t&֍"s01:t&H8u:t MD$ $,t&U$D$聎 t&4v t&֍D$M $D$&Lu4$%D$&֍[M $D$?&@ @"@0 MA_Q $Of5:}}J:}J:HR:PED$d$jf(@QHIuT$$t$Q'&uD$D$4$CQ uE‹@4$D$IbkD$ D$D$4$臊f,cD$D$D$ |$D$B,$軮@ D$D$D$ |$D$@,$耮@$~{8ƋE}E܉$\$躟|UD$$[>MAtE1y Vҍ t)&A< t< t< ft< t< uuމVuFU"BXM $D$08eu4$UHu%D$4$|+A EЋ@,u4$D$o.M $D$N|D$D$D$ |$D$@,$ȬD$$78D$E$ˎVED$${>$|7828D$ E‰D$E$ҙ?8D$$G}cD$D$D$ D$D$ T$D$$-D$U$D$輘cu8D$ D$4$*AM28D$ D$ $D${$苮vU8U ]u}J-Ú AE1 G%FGF hFGWu %p ЉG]u}]D$$@u냍UWVSi ,uD$$}z@t(vHtI tUD$4$ыU҉uۉ<$賲,1[^_]É'UWVS,Mv pt~tWu*6uy td8$耩@,[^_]ÍvD$$MyMʉETt$M $WU$E E,[^_]Í&'UHuu]}- P u]u}]Ðt&D$y4$萠t؋@D$D$D$D$D$ D$D$@$$螪H@=;1@Q$tJɉJt=A$@ GtP҉Pt+Gg vE$UE볍$@ˍA Q$xdD$A$D$蕕;87fE$fstE>$`tXvAEB u@;E}A$1t&$U襤U׋GD$$@D$$v'UHuu]}} 蝰 H WD$D$D$D$D$ D$T$@$$表@;tiR$tJɉJ@B$B WtJɉJtnGg @$}D$4$D$蹏]1u}]fP$HB @9|?HB 9&E$E낉E$EAt&xt&E$UrEGt&E$=rEt&$UM袢UMd UHE ]uu}@躮' %@ P$1ɋ@ uT$4$p]1u}]Í,cL$D$D$D$ D$@,UM$EUM@ tQL$D$D$D$ D$@,$UH]v$萡;L$D$D$D$ D$@,U$贠D$$UfF_V4$跫v'UWVSMftRt D$E$҅tSH P0tH M?D`?uH #Vw}ɀ<uuvU$襪<1[^_]Ít&'UWVSlE f @8~pw^<UB<J„t8t,z u&R tRt2}@Ffl1[^_]D$p}|$$ߊl1[^_]Í u51(W RL uIt$D$$Q뇸ƍD$4$ft㍃D$4$Pu듋}G @.uF  @ f f uF  @ LVj}ƋG& @E@ @@ @@<$Π@ @8E$9qG<@ @0D$D$U$yF@1 D$E$Qx }T$$أUB @Er D$D$4$‹dH 4  }G% D$E)ЉD$B$UD$D$$D$D$ D$D$,8D$@ @$MeM $:MUA)% T$4$D$zD$D$$D$D$ D$D$ƍ&8D$@ @$4$ʐ$՞UB< 1M $,oMuF v @4.xgƋE@ @UB E @}G @ @0 @F(uF  @  fK f xMA  @X8ILq?&E@  ‹@Er $ijEIEE < t< t< t< t&t< tD$ D$4${M1ҋ|ɉEOMu#/< t*< ft$< t&t< tt< u܍t&< t< t< t< t&t< t'}Em}݃|z Ẻ$D$mD$ D$4$U=zM̋UD E9EȉM)T$uȉ4$UgU$f fE@ wxdG euG F @$}D$D$$D$D$ D$D$ƍ,cD$@ @$O4$'4@ @@4$U@ @8$kG4@ @0D$D$M $AtF84tPM҉Pu$}<$5xF`<-$ff@ @8E@ @G0@ @p0@0xMA @ ˆD$ D$$w?guF% =YPUF 9L$D$$D99UB% =pB @ pUB x@MP t $sHMkE@ @\ ff 4MA @ @0@F, E@ @%`tP҉Pu$JUB<t|f uz1҉}ЉUm؃tz}݃|zẺ$蒑P`8NxD${$dR fB}<$t D$M $@zdG }ēD$4$ȚE@ `8ED$"D$}<$)UDžt1E1E  M M9r}dG(tt t$ uG(}]BD$4$tP҉Pu$`}G<fu E$s<1D$M $贒eED$D$M $~t T$D$ ${EEƒD$ $T$mED$D$E$6~U`M|$q~ 1҉t\;u ;‹0$j 1҉t9Ⱥu͋|;D$$܋W1҅t\;uD$$_虚 1҉a\;N|;>D$}<$wD$M $D$}<$ϐD$}<$跐ND$}<$蟐 mD$}<$肐D$M $j'$=_t&D$E$@0X$;}G<08t8D$$oE$mcB @D$}<$豏RD$M $虏D$E$聏ED$"D$M $™D$M $HD$M $0E$]D$M $D$u4$9UB @}GD$% D$|$D$D$$D$D$ D$D$,8D$@ @$UnU$CUBU% R BMPUy WD$}<$E@ @ t7}u1dG(ttt $vsoG(l}G PU܋G dT$D$G($^G(@.&G @KW fBQW$ \+ED$D$M $聗ƋEED$"D$E$]UYD$"D$M $:8D$D$ U$yd@(^D${$~D$E${)&'Uuu]p P uM@$t$D$t$w@$@ @u]1u]Ív$]1u]Ít&4$_맍t&UWVS\EU肗 } Ept^ >MvM<u6t>FEV B$葉'U8uu ]}}-Ú F D$D$ D$F D$FD$ FD$D$$H1҅t9wt]Ћu}]Ít&W'U(]E 覒 uu}$wtTF9t*Vtt.FF ~Ft$S]u}]Ít&T$D$4$kE D$?$a'U] v uuD$$yJ V DL@ @P]u]Ðt&UWVSu裑 F u>$ʇf@ F 8tۃ} d@EUBLUt9t$ED$U$|tČ[^_]ÍvUBu荶$ D$<`Eĉ<$qcED$}ĉ<$$|D$D$D$ D$D$ D$D$4$ttPс$ 谈$_EȍJD$ỦT$D$ $D$ D$}ȉ<$K|D$ED$D$D$ D$D$UT$}ȉ<$JGG% GExUċBB% BT$}|$E$shČ[^_]É4$PE- @ P@R E}E}UU E̍JEU&uUED$$kut }$|$E%Up HEȅMt&D$D$D$D$D$ D$D$Eȉ$׆P;UtpH}̉x$D$UM@mMAUAEЉB :AGz}ԁD zIEDt E D)BT$Uĉ$mU5Emx B D<@$M6Q$\MEȉL$}ĉ<$jMHG ɉEt1uЉ v$`bUԉD:qEЋ8B% = u΋@ uŋB $_$ a$Y\ED$}D$ $D$ |$ED$Uȉ$yD$|$D$D$D$ D$ED$}ȉ<$@$_D$Eĉ$蝀$M=|Mf>|$$螂UWVSL}Fó G tP G Dt p@E 11ED$D$D$D$ t$$xEtEԅ"P G D@} tWUԅtBJD$ED$D$D$ D$ $wt/TL[^_]Í Ju؍&Eԍu$L}ԍ&D$<$Ttt$$(UD$T$$tŋJ P TtBB t$*L렉$zߍt&<$pz?$݀t&U(]艊 }u 224<2)u=|D$<$ft:$ \02]u}]Í?D$E$?|$$' Uuu]É0 F tHP F Dt @t#4$D$]u]f4$@y֍?$>$v'UWVS\EFó @ u@?$mt&‹@ B t֋JUMtȋ@E}ԋEP҉PE@uԋFt#P҉P}GEԋ@UMD$D$D$ T$L$$utEtẼ} /M̅JD$ED$D$D$ D$ $tTEMԋAt$4IU̅u̍}4$kIvED$$P|$$豀UD$T$$|tJ P t7Pta҉PF}uF Ft$}HFZPt+҉PF9$J룍$JٍU$gM䋻xP Uċ@MЉEȋMȅt&uD$D$D$D$D$ D$D$$~p~ MED$|$D$ $L$D$4$8rE̅tfỦ$Guԋu?MЉ$L$ UD$|$D$ $T$D$Eԉ$qD$4$NumMȃE\[^_]D$ 4$pd9vF7P҉PF$fv$f.$tUԃB E&uJ $H$ Hf7$Gvo$[fv$KfvUԋBPt;҉Pt>MA$ fu4$tEf^${Gv‰$e벍&'U8]Æ uu}4$|NjF |$D$D$F D$FD$ FD$D$$|t ]u}]ÅtGt7Gu<$1eF D$ FD$FD$|?$y<$Fэv'USNû $L$a1D$ @D$D$D$@$_$[]ÐUEVM Uu1^]fp~u~:uppPu(tp1tp1ɃpP DΉ 븃@t믍&'UWVS| 0t!ƋF$y7u狃[^_]Ít&'U8]Æ EB u}׉$>s|$PƋE$UD$_ED>U~E D:E t E$y]u}]Í'UWVS\uU 胁 E܋@ 9ЉE}$׉!9t !!9u9~9~\[^_]ËF ,UF%ЃЉ$Fr‰EEEF M$UЉD$L$w^FUЩE}?<MЃED$F UЉ$1wUЋ,U+ED$$D$vOU܃}z MN JU؅1t&Ut@֐t&P#U9)M ɉt,uԋE9}E륐t&M܃AˋMщMԋN @ ȋMԉEċEċ@AMċEԋIHMċI H MċAMԉAF UЉ$vU&WU܃j],D$$7gE&UWVS\t EE AtA\[^_]Ë}ԋŰR #x UЋt9uS9tF‹uu1}|>EԃD$@T$ D$$Mg5UЉu1HɉHu  UЋ$u}̃o>Eĉ$su\[^_]ÍvMUE}ŰM̋p U #Q }UЋtgU ftZEȉЋPM U; uu;ruփ9ut}M9}uNj}uT7 ;UuuUȁEu"@EM̃iEE؉EED$ED$$M=EċEE1}E ;uDEEUWVSu|3 tKF F t<G G u)F1D$$h>4$vRuʃ[^_]fU1҉ED$$1 UE MUE1M vU(E]uu |m HQt@]u]ÍA@ tPUA@ ]u]Ðt&UT$D$$IzUӍv'U]uPp{ݖ Ѓp ~+@t^PvtV0v@T$$pqtu勃|]u]Í&$d]u]f$,sVP NJB HʁDPVpPuD(H돋F$e]u]ÍvF$}s]u]Ít&'UWVSLUfzӕ u E}WF"IMN MEEtF% = J}|t Mϐ1 Ɖ19u 1ȉ<}ċJu;1uW&y;}}uE9}M΋Mu1}uL78Mu$H-t&} vҍt&tJu;1tu|u܅tUEԉ${pEԃL[^_]ÍEUD$"D$4$wUԉEFEUԉ$:pUf%E܋|됉%MۉEx F x}J&UVS}x t[^]ÍD$$vf 9ʉRuǀ[^]ÐUSx{ ED$%$e1tB []Ív'U8]w6 uu}} D$%4$etx ]u}]Ít&t|$D$D$ D$%D$4$hu*@$=뫍t&U8]9wæ }}uD$%<$etF ]u}]Ðt&D$D$D$ D$%D$<$guE@$l=fU8uu]U }v F uz]u}]ÉUD$P4$mdUtAZUNjBPtT$ D$|$4$MD$ @|$4$D$mM댍vUSEvu @$xH$0E[]fUE]uu@ @ t:R P rt$Bt$$?`Ft(Ft]u]Ít&4$W荶4$8]u]ÍUVS@ Euò tTR $T$_NF R D@ @@@[^]ËD$@ $\fUE@ tR P ɍBÐt&CɉBÍUVEu @ tR P r^]Ðt&tvUVEu @ tR P r ^]Ðt&tt&&'UE@ tR P ɍBÐt&sɉBÍUE@ tR P ɍB Ðt&3ɉB ÍU8]u}J`s͎ t1]u}]Í&u܋J qtҋ9Q(u˅$ED$ D$ ǍcD$<$AD$ D$<$CtWt!҉WtOB(fH<UE<$5EٍbD$ D$D$$#E뱉E<$TE롉'U8uu ]M@rí }tMA ~uStGGFxA uk$Si0]u}]fP A DtMFMtG P u@w $zCMgf$j듍PzBtFBtLFat&M<$}4M7t&M<$RMt&$P4뺍$RF UWVSLpf ҉EU@ EEԋMuq 1|9PuɉtURU܁MR UЋQ M;D uqE܋U @BmuE01V~t U$QV)1~Mzrt $3V9t]D$M $aL[^_]Ít&D$M $4댍&mmL[^_]fMj%Ub뗍&'UWVSo \$ gEԉ‹@ E̋z HuEEMԋ@EE̋I !ȉEMUM fp}9>u9ut3UN;Ju܋}؃ut}T1փu}9uM ɉMlMЅtUЋE}ԋUЋ)PMԁIȃ\[^_]Ív}ƋG@GF1;|UЉFUt#}7Uԋ@M ɉMoMԋ@ҍD$$!V}ԉG &'Uuu]mP @t%4$St]‰u]&]u]Í&'UWVSLEċm Eԉ‹@ EEztMĉ $jS"U,MUȋA%ЃЉ$a^EE̋UċuEB M4$D$L$JEċ@Et}? EU%ЃED$B $Lc,E+E̋uuD$D$4$;EUԃEB EЋMĉA 1Et&uЋ tmEE!v01202Etp6#u9uփEuEЋ u܋E9uMu9uNƉE؃9}w}uUċBdM; S%ЃED$$SuĉEЋvuvUMԁ UAuċF% FF }EEUȋM4E؋VUMU܋IɉMt$U܉ύv ȉ 19u 1ЋỦDžM9FPL EԋU#x 0u؅eEu9uDEċ@ EU$auЋMĉq L[^_]ËuԃFMԃiUċB $a,E+E̋uuD$D$4$8EUԃEB EЋMĉA }UċMȋ@ 4Er <1u#=1,fЋUċMȋ@ 4Er <uHuE1t f8,fZFf UWVS\hɃ LEE UEЋUMԋp #Q UEtwMU؃M t&tjrEu9uM9Nu9ut }9uԋMċuD1;EuăBE tu܉Uȉ4$_UȋBL[^_]ËUUfE$XuM܉t$L$@Uȉ$EUD2rur EЋM̈D B BBu؉2EMԋAAt$u;F QU}U9A0UWVS,E UUfI EP@E$O8Uƍ@$T$UT$2DEFU|ҋt'U}אt& ȉ 19u} 1ЉU$E|$Ft E${]UF V,[^_]ÍvU$N8U܉ƀ t 0OU@F?vU(]e& uu 4$Cgt$ D$@D$@$D$E]u]Í&UWVS\} VeÀ uG:RUW EENtg@E܋F E %EPEEPtlED$E$D$%}у M;t&tc0 DψM}EEuE܀}Eu|$D$Et$ L$$Ea\[^_]Ð;|EttwEuE܉UD$"D$4$bUENED$"D$<$b‹G&E@EE@BfN A뀐U1ɉ8U uu]c  ҉}ExL$M $]u}]ÍEډD$EUED$4$#1ɋU}ρ9E몍&'UWVS,}cÃ~ Eu @ H R ʉUt1D$$M|ɋt$M<fʉ щ19u1t%҉ 1ЉD$E4$D$OU,[^_]ÍtEt&zED$^@$nXU(uu]}b}} FtYR <~ Wt@u$G G]u}@]Ít&%FT$4$<&fIɍ&UWVS~E$U6t7F9tt@  PuÉ$Ð$8:븍U؃EM9J rMA 끋UBt.MP A tt $7ED$$>U,[^_]ËEED$$IUB t?M1Q }Um؃tz݃|zw^T$D$$&UBuU%~BB$-MA4$?D$LA$MD${$Mt&'Uuu ]SWr t+Ft@$w&FxtEt$$]u]Ðt&@t@$=&͍vU(uu]VPr F t0D$P4$Dt4$D$X/]u]Í:Qu"$D$EE]u]fI T$|@$T$L$ E>E]u]U8]9Væq uƉ}:u5U$E|$T$6EtH D$E $)LU$ED$ T$|$IE'UWVSuUq }u1Č[^_]fUBuV;UUuރ9uut }9҉uȋMȋuԃT3UuuEUȃM;Et4E  };8UEt MI}G;|( E7tP ҉Ps U EP f<$JvED$"D$} <$Q&U$E tu F% =  u|t#U֍t& ȉ 19u 1Љ‰U$?t&ED$U$^@PJHE Mԅ E FMJt$E$'VMԉU NE$fH u1U}Mu ЉEEȉM̉MEF  E@1t&P JwPuttEu$D$D$t$EȀD$Ẻ|$D$ U T$M $I p F.}UUuv uE}}Ek}}ut U֐ ȉ 19u 1Љ‰U$MȋuE$}̉M#F EEfnUЉ‹BM$E;up;uuuىƃ9ut}̋M9}u}ԋuD7 3EuM; B|9 Ett @  E 1EfE@ *Bt#H ɉHu$U1UzU$}LvED$ED$<$UEE}D;}UME$st&uF81P JwPku EE U08tM AI1E $y#$E D$ D$U T$M $%}t}E<$E1M|9AEnEMDEhD$P$;M {u 4$"E1D$ ‹EԉT$D$M $U$U0F@FMԉHV$D$ UN,U@(Tp$E`vUFDƁČ[^_]D$Pu4$;00U ҉ESE $!$"D$ D$UԉT$M $$E7D$pMԉ $:4$D$2F@E<$C:1 $t&E¸1t&EEED$uF $4UB 2EEnU1$CfU$#E tU B% = u|U ȉ 19uEt EvuEEUz WE@ EyUB U;ED$U$$UEFE$#EЋM ;|N0Et EHMA҉A};G 1E@ * vuE$<3UE BM$D$L$ED$ut$ED$ }|$E $D$@BFvML$E$$UEXFAoEv5u4$@E}v;vEED$ED$<$ UȃEEȃ}D;}UtMUJ JM̋2u7D$p4$7D$p4$ M4$Zfx F @E$zD$MA $0uljF }<$EMЉ}?}Otx E@ ;T T$M $ }GGE`{u6uED$M$ $EUNjB$AMyRM M}t D$ E<$D$IDE E|$D$ E D$U$Zx}% D$E<$D$CEkELE@$!0UE $D(} u~F &<$;>vB$UUzM $U >U}t)D$ E<$D$%C<$=E|$D$ EԉD$U$$y <$=vMA d6 x gB @E$_9E M $B($]'$UUf(U$ 6FUEhF 804$X>U@JE% D$E<$D$UAUE E}1<$M3Z x=MD$ E T$D$L$MD$EL$M$L$6$[]زfUHuu]c>Y }F >W F DE䋃8u4$\htLF J V TRT$UD$D$D$ DT$$)D$ D$D$4$}7fF $4G F D$4$M/F t4$]u}]f1a룐UWVS E&=ÓX @ @8O Wq9~<4U쐍t&M}P <28WUU9U|ۉօt~H 4Ut&1;UtBH u8w)t!<f0v>uP@P [^_]ËH 봉'U(])<ÖW uD$@$*t ]u]Ð4$D$D$D$ D$@D$,H ]u]Ð&UErɃ Í'UERɃÍ'USEh;V @ u @[]f$.[]Ív'UH}}]uu ;ÊV G u2;pG ;vD$P<$(UUEtwB)7BD$D$D$ D$T$@ @$&t.@ t#P4Hu-G @y&1]u}]ÐEt$ D$<$D$=UD$p$'D$E$ UtUBtYtPwtUB 80sG u@hUt&<$-vu#U U@R@ 80t&D$D<$E&Ut&t&tS f<$G,l&E$}1b<$06$$[1'UWVS,u68ãS Ft)@ tft x I4$sx F @thxN t^4$8 멉${4$ 'UWVStu4FD2A>O *   td t&"tx}tuFdD0@]u}]Ð@ y utUD$P<$<[^_]ÍvU܉MFM؋Uo&fM䋋|t&U܉MU܋M؈E UWVS9 ld1Mu@EDN u ,WF$uU4$U֋J$AEt$EtEt E̋A(@ @vB<mE$t$MM@<t$t@<@ pP$@< UU @0E|B;BB|B@BU+ P$P(+P P(PỦpPRP(}@҃(RRffPPBR~T$M $EE\D$!$E M}RŰQ M̋R E A @U+UŰ`R RP `R AJH$P,P z9}cE1҉UԉEm؃tz݃|zk}̋A EUẼT$D$E$UMMxM̋Uut`uxdM @ l[^_]Ðt& 6;x V}@E܋EP -@t/} |GD$dCT$$UCUE@% D$E܉$D$B< U}Eu`@ PHYtt$$$EUQEU 4$P$}l[^_]ÍF @ D$ D$4$L$pEHA9v P ủ;Uuz f t&;tWF$uF P ED$ED$ D$4$E4$wMUHD$ qL$t$$UoU@ P҉@WF$&-Pt&Fvx}y 9}t#+}P EA P 9Ul}1҃x ẺUԉEm؃tz݃|zED$U$MPMEUPQ Af+E9MEm؃tz݃|zcER L$T$$MMM :v $MMQQE-UMUBM&FD$4$EE^U1Ẻ+E9EE̋64Et&$lWtt(@ 9p34$&vWF$uf4Ẻu4nt&EP t&L$ED$$UMMUE/FD$ D$D$$MgD$ $M@ p4$舺uN@V @EED$"D$4$sfz<J(ɉMtuA P9R}t U2uU H ^F$vIV VyF$YMuElFD$$21USD$ D$ƋE4$D$Ct$$UC$jD${$Rv'UWVSi LdEx7(|U܋rvrBUPuUԋ$p2(P  p2PUpPtXtSHxE‹t{t@u؋U܉2UL[^_]øuuԃ9uU@ UԉBu띐uԉu닍&|(BRu܋6@tuԃ9uMUt&9u8@ u$qE׍&)|uEt$D$$+u2Ȑ$vUWVS9 \|81J4IrjJVN$(F  NNM܋|FE@F}]}(E8|h `P BtPc҉PP F BF$@ @zPM҉P$ F$$|$F$`F$HF,V$@ FtV(҉Q}܋M9F\[^_]ÍvfOF@<h(M}u})MԉEx; 9FF}׉uuEԉM0 t@9}n;t@ tËUS|jE `J Qt$J.ɉJ`J EP QP$UB @ыRU؋Q ҉Q $ M‰A$E؉$D$UB$`B$HB,P EH$ E@EtUJ(ɉJ!E܋MU@ EEEЉD$D$U܋}P҉P$f@ +BB F$RP F$@}}9u f9m@ uM$M؉$訳F=$蘳vF@<t)M؉Ex;e9 u֋U},f ><t@9uAutÉUĉ $UϐJ9riFx?}G Gz;EEM$谾M(ωUKt&)ȃ|Iϋ(M(uM &$P F+L$D$Uĉ<$Uč  |t&@ =BfU|h U`H At$HrɉH`H F AN$A @@EAAU$ OF$M$L$F$`F$HF,N$@ UċFEtN(MEA(E܉Mt&DUĉ$GU&JM؉Ex;.9}X|h `P BtP҉PP F BV$B @_@EBB2$ F$M$L$F$`F$HF,V$@ FtN(ɉJ#U܋Ev;}؍FBB‰D$XD$ }Bt&$xvEU܋MAJUB$t&}ut&(u}؉Et&$xDv}G;EUĉM$UĉBUMBB<}M<$M(ωEJt&U R +QQ UJ$RQ MA$@t&(M܉EM؋A!M؃AKUĉ $U8M $xJA t)?UD$p $Uą!}䋃z&tRw݅undNBf%f=D7B]u}]Ít&t 농&$m@ 80Yv'U(]Iö u}>tEPu%tXPt'd>@$tRwuVd>]u}]Í&t 뙍t&$눍v@ 80t U(]i }u7thPu@tkHuMdNBf%f=D7B]u}]ÐtRwŅt@ 80벍vd7ft Ѓ냍t&$m&'UWVS L8}ą4Pp" }E؋}؋PU܋ U܃P}9Ed@Et&EtEtUȿUԉEĉU誻x>xOH+Hx>M܋MxU9}M܃}D8L[^_]Í&t"Rt@ 80 Mt&($EMd` AuL` I Eċ@L[^_]Í&t+ ?q 뱉$p@t@;ƋE܉4$D$觞7Ut& Ut&H 4M܉4$L$U`UF @u?)~7{|$<$D$UUԉf4$U봍vUS |BR@D;8Dh;}$Zd[]f3'UVSj 0Pʃ wptZPt)$ɾ@ @t$d[^]ËJtʃJ`f wxD${$낍UWVS<é |8)|P4Rpƒ tF$蚠V$Uu4V(E5dA1N,}9B6.B N, M̋E̅E̋@=EE̋Mԃ@H}uE;EM̋tBBGxW}N,F9~4BB EԋF,F,Mԋ M:GWd|[^_]f|$<$D$lLt&F,V(E@ q0vu@ EB@;EM1~u F`$UMFUȅFB MЉ$L$UUȅD$$ GxF(;F,U yu APV($MUMċAAR~(xGWd|[^_]Í&F9fMt&B @t&uD$"t$$UnUȉExvGWd|[^_]fE&G6f$舙RvAF,$D$D$USUȅEF,É$訷v$Gv $舷vPV(D$M$)t&4$UUUt&T$D$4$U衵UM=f~,6F(F,#$UȉMUȋM_& $`v4$UMUf7v$ UAEЋA(y$D$D$ D$yD$UȋEЅҋtBQ$MЋF,B@ MyUD$fU$y t$ ;t1+dt$$]Í&Cƍ&UWVS y d0P@M̋t y 1@EMt EtEt虵EԅG fJɉMj}$,fuxL>iD$|$$Ht&x MfI 'y!t&D$q<$ES ;b+ )UЃB1uԍF$t$豹L}7td7Č[^_]Ð9EtD$D$Ẻ$UB @uyM̉ft$4$D$ܳOt&}uW}eŰB&}D$Ủ$MQt&$踺zv$Pt$蜠EEEEЉ}E>D$UĉT$MЉ $v}@Mu08@uHM }G @8)uЍOMw}MA y}7UuH}uBEЋJB )ȃPv0q(;PGƉB D$UЋB $轺MЉA &d}>Č[^_]É|$<$D$ It&<$8v@F Eu6G}fPvPvPЀ vD$<$ tNjH}D$U$T$f}ЋJB )ȃ $PF$n}Ev$,sED$ D$uЋ@+ED$EF $P?MF B19s,ET$D$$,j t&}tR}uFuЋ@u:U@M u/4B<fuMĉ $5vuĉ4$U@M$讞E}D$$v}@MuD08t0D$D$ D$tD$UЉ$et&1d]ЃŰ@ Eu B }MEEMt&4 rMЋI M(t& xD$D$M̉ $1EPTt&D$P$P\vЍJ(% =!D$D$Ẻ$άMQf<$$萛vM`MD$D$ D$tD$UЉ$M vBM t-BB @-$ӏ$;ED$$t @MuLt&$Lt8}d@|$%D$$赽t&}}M̋Q M̉%_Ai@CŨ9D$Ẻ$赩XM̋Q^u) tD$D$Ẻ$ժŰ@UЉEE&M̋A  $?}fJ L$G $蓴G vuЋv uQ D:  UЋhJ M }N|$$赛E6A @Ẻ$زŰB $}̋GD$ $蕊}̋WP$諌$D$DD$}}'D$$腋F|$IET$ L$D$S`M~D$ D$D$D$D$D$ D$EЉD$$CB  D$UЉT$$ը@ @ @@ED}E̋P ủ%_Fur@tủ4$UUE̍rBB f@[@D$ $@ @űF뛉$賰P4$F~D$$~M̋QND$$蓴@ vUWVSÉ d0EPxуɃMh@ hE2P _ MA @EA EE MMM@'vE||UB t$@ `$p@ UJ EԉE@\‹EԃUЋP+UЃMExEԋP(;U MLEԋ@8~ UEDžtERUЋUԉUȋEUMċME%=ED‹UɈEEȉỦl t&HPMЃ9UQH0)ʉUP(9U U9U MċUăMҋM̋UDUlU@$`t3U1B t$J W8M@L$tL$UT$ML$UT$ ML$Ủ<$T$P@x(UB yB }t H$@'t |}]@8EċEMą1҃}!‹щMЋ0);EMx;9UĉUUЍTEU苧MJPtwITti)щMȋMуTMxxUȅx U)9U~ E$UȉT$M̉$L$ۣE@ t$@ EUԃE9U\UMA!@twExlD$D$D$gD$ D$M $ֳRP:t@RP RPUԋQ0M;Q2` BPtJ0E;HtEMUMɉ0UUĉUCt&}HFVd[^_]Ðt&E:|MA Emv@uf`B qE)t$4$D$聣H$pA ;P E豿dEPPMąu0)t$4$D$Ƌxhh;}$d1[^_]D$ ED$U$WE(҉xzUԉU@PMIMUHD$g$>AP x]Eԋ@$EE'Eԋ@PPDžtE UA MIEM1(URUDžtEEEԋUԉUEu:uEf@$MMȉL$Ẻ$.6H (EЉ$dd^t&EЉt$4$D$ddf‹@D$g$)t&EpAM@L$D$UT$ ỦT$U<$T$`P`EMP$Uԁ:EEuEt vUB vp}tUԁP$@$EEt |(xMA yA B$%B$@TEUPTM̋@P)щB&B,D$M̉ $d蔓dBP+MHE+EBXH MA D$"w}hh;W}ZFVd[^_]ÍG$考HUtiMyRlD$D$D$gD$ D$E$袭RP:tRP yPQ0;W` hh; Fx;MIDžtEEMйoE@!@UzxD$g$۩@ $s$d2BPJ,H%Eԋ@PPDžtEUwxD$g $ID$$茨@ wUԋMB0EIM1`BT$]B$+MIME PtEH e8B$tM+lL$l$d`ғdBT`HXH$U+l@PHPP,Q@H@D@8끋M̋BP+MPPH,Jȍv'UW1VSg E4$nD$ 4$y@ xOC$@D${$(UWVSܨI L E܋ d4)M@@z J ȋ@ t x *E&$ U)UĄNh Eԋ)ƒPHdL[^_]Ít&RB YB NHɉMt A 2HɉM$MЋ@ E@ B u<ff9ur*t&M؉L$${~9}d@f%f=`tB<UЋ@ME)ƒD$D$$褈xPHdL[^_]ÍB f@9u<}f9u)|$$zu;uvE؋D$@ $|ztΉD$q $UUąE[Eԍ9;\V+UЋB&U܉4d@f%f=tNc5D$$踌SUԋdL[^_]Ð`4$袠fD$$|늋+E܃E܍rE)Em؃tz݃|zAD$t$$;EfD$D$$|e&M؉ $%$sst&M؉ $v_&M؉$L$x(t&B @vvD$U܉T$$MօMĉ)ʋE$U荟UĄdMЋpD$L$$;fD$D$E؉$L!U؉$X@ @E@ D$q$UUąEvd@%D$E؉$D$L$ U蘞UĄod@%D$EЉ$D$ FJ z D${$蘘UH]Iö }u 1 7dJ  VT$D$ FU $MD$jMNU]u}]ÍUWVS謡 \d0P@UlNM؋~@ P B }D$L$҃T$ $荓d1B@Nu G zMD$D$<$ MG @^~A t Q B m$e‹Uȉ$VUȉƋB<ffu mEFu }tB \$<$ȄG @M؉9d\[^_]Í&P uMuF t$@ Ouȋ`$E@ U$EEUԉM&UЋB%EԉЃ}}DE`tUu~uȋpD$D$E|$D$ EЉD$Eȉ$UMVUMEEȋ0L MMA EЋND$D$uD$|$ t$ED$uԉt$Eȉ$UQUE̋EąMA t }KMA @EI uEF t$0F EtCuȋu;p,6}uu+@%@u%}jE@ vZEE̅uu}ЋG% =@E uEuԅMUȍE2F$EtU<$T$iV\F)ЃUԉUV8UЋBuE:u:EvED$D$UЉ$^N&=G$E9t&(EbPUȋ2F$EUfED$"D$Eĉ$U|U-E1E&pPhU;a1dČ[^_]Íu@ UyaU9EĉEtD$EĉD$M $]UD$u4$U LUMA tx@EI Emt&u̅UyMЋA% =u@Ey ED$D$uЉ4$6]&ED$"D$E$U[{UEt&E8E"U1EB @Et&}GuO`B o EЋ)t$4$D$^&W EfUȋH$MA fD$D$E$UroU`MMA 51D$Eԉ<$)D$UxEĉ$D$;dM(uɉ0UҍMGU}EMU/Eԉ|$)D$}<$[E`D$D$$nD$UT$Mĉ $I`Uȋ@PxE}UȋM@L$D$UЉT$1;}ԉt$ ‰T$M|$L$Uȉ$PEẼ;ElMȉ֋@'tpT9t)׋U<>)ʍ M@P}Et MA D$ Eԉ|$)D$}ĉ<$Ht&u4$U@U끐t&D$ D$ML$Eĉ$JHt&}}^MA ?uE+EԉD$}ԉ|$E$YUbD$D$$lD$ML$uĉ4$^UЋH t>B JMЋA @EQu؁fF F $>p}ЋMċuЋQ V RP@ B 1A t$P }G EtE1UY\~Fủ$t$:MЋA%_DAUu}t u F}tEUB @Q08t6M9t.D$D$ D$tD$uЉ4$vvhU;}$Ed9Č[^_]ÍED$BD$}Љ<$>v%=$Ef$0 F $@ D$ E+EԉD$}ԉ|$Eĉ$ED$MЉ $)8}ЋG)D$D$<$xsE$`B |1E̋F;FF1F @NAuQqEA EyfAUĉQuЉqEԉy AUA(Q$uȉq,}(t$ $GFE̋d@$BhpP};9|d0 <$C߈UMvoFMUA @EUM(MЉMGauԀ}EEuUȋM@P0P))9ȉMEtD$E4$D$URUu}~M4$T$L$cuU)pEtMxpPUЋB%DB}t MB@08t3U:t+D$D$ D$tD$MЉ $'s}y}ЁO jEuԉ}ԋ}ȉEUԋ@P)t';utL$t$ủ4$UMbMUM̋EupuԋHP@qD$D$M9҉L$T$UԉT$ Mt$<$L$PtJEEă;EbU$A:RD$ED$M̉ $UQuűUi}̉u9t0EU)uЋ +V ƒQD$}ԉ|$Ẻ$aEtU9VwG}ĉ$|$]5(D$E+EԉD$uԉ4${oEtD$$#`@ yEЉ7$[7u5Et})Ɖt$}Љ<$2ED$E4$D$ Px+UD$|$)Ɖ4$U`t$MЉ $?2EUAD$u$t$O)T$UЉ$ 2UWVSqY ,EEhtdyq<99wF9v9Fw$c]u}]Ð EU $bcEU>Ѝ&'U1ɉWVSlukA VMU҉U܋U܉Um݃|zɋU]]$T$U}1+}̉M}mEEEЋU̍MЉD$D$<<$I:E܃EԉFUЉu̅tqEfMЋtEMfMut(Jȉ 11#E;EuΉUuu؃EE9Ev E띐t&l[^_]؋D${$`t&UWVS|j ,0~h FF2M9FL09s%t&P9щ@w)A|GM䋓Mt,[^_]$ZhAAAUQ RB9uǀǀ끐U]Iiö u$ uZ@@D$$!Q]u]Ít&'U8]hV u}2t~;~r*UD$$P0@SUxGFE$YB MJM J]u}]Ðt&UWVS\hɃ ,UìZz2D$<$f6)׋Ulj}r0ߍ&щ8)9MsU,[^_]Ðt&UWVS}};E<}t}u4uԋ>9}ԃuЋ}6~u<[^_]ÉUD$<<$PU܅F N Q҉UځfV V $E`OEMԋ}~ U)BMȉH >}hT$4$lG>}RfUĉT$M̉$L$J5EE&V 눋MQUdUWVSD~4l1 ύ  9Du Dt1t&09u‹h (t $tdƅ$ zm@+Q P$dDžX)dDžDUօHEʃLH t&1҃0uH1HD)Ȁh9X)ǀ0DHfЃxƅL-.@T$$7@@Hhjf#ID$$0t&hlt&HzlHx%sHDžh$xƅp%dd@f%ftt f=D$"C/ +d|L@f%f={EЍpJD$LT$$8/;DxLD$ D$9FƉH1HD$$CH9D4H(D$1LD$ D$t$$9HP^v$D$LL$$ŀ{@ i$ƅ@ ]KL$D$L$LOx9t&)T$@D$ |$$v@@tff< +xt&xf@O ƅzBxJ*5A< DžƅrB1҉DžHxTAvyЈ vHVƅt&Hy;hsh11DžDžDƅƅ$vHxIqxP$x@ƅ,$@  ]HDžƅ zU9;?%/s 8L$D$ D$L ]HDžƅ XT$D$ iD$ $g*X9xHJƅpf$haqP۽(p(D$)L8<$g#DD$$lXq$ƅl-Dž DžDqLۭ(D$D$ D|$D$D$$&P (۽(fPP0 U9   T }։H<$D$T$ ƅ )hG rPɍu@ Q@1)U9sM9HxiD$$#H@ I۽(E9tWɍu@ @`Cƅ1Dž}]D$@ $D$K6DžDžD$d,[DžhHA u@hy HB {$@ it;hƅ ?h9+|DždƅFHfxHxT$$1x<$'h$,)ƅ 5hD$D$"$~+Htd$D$"D$S+赧$D$;G<$XXD$)X;*‹ V 9U~Kу2D$$E DD$$. l$!D${$!$H$2`U9: $‰D$dD$pB tN@dB ƅB t$@ $;"zd$D$"D$f)ۭ(E֍h $ H11DžDžDDžƅDžƅFuF1ɋ]ȋu}]Í&t;t;|tflQt&vuutU1t&Bt ЋRJffzftft׍&čF t&R4@ 29x )_HD$D$$ fFf@P t €@fU]uU}]v]HD$ D$D$$"@ 98y\HD$D$$dfVBf%fB2Bf%f.Bv}D$ $D$D$$EFEF@t@f%f@E&~}D$ FD$D$F $$1uvd90FENM@f%Hff=EEHAf%fIɉM }MԋA HE܅tE@f%fff_Ak}}GO f%f~f % $D$ D$D$E`F%Hfff  fzFPff/@E-@ @MنM̅1v ɉT$ D$%|$ʉ4$EFEvF@zFV 9VD$b $D$MM:FP}F D$ D$D$}rNtfRCt&N fA9)vut& vt$It`B tD$$ @ RQ py;me;vED$"D$<$A E|EEMf$B * rMЉL$Eĉ$ ‹$D$UUB @EЉEEJ EEMċ}ЅGMɉMt&$`Nv|EEvM9MDvED$Uȉ$ ‹$D$U UB t[@EEEJ EEЉM5ED$"D$$U EċMEEUMЉEED$"D$$U} EƍED$Uĉ$6MMЉEԋEUԉEU1ED$Uȉ$MMЉEԋEUԉEU1t&UWVS|u} S ' 9.F=  uDW FM D$<$ƋdBf%f=m D$rHt$$vGE9} }H UԅuD$4$FV%_F= FRPGyN&|[^_]Ë Wt&F `FUD$V4$U4$UfD$4$vvGEy} YF_VV4$IO%= t EŨ} FM;URЍJJMЁMY_VG t@F E FG%~<$n08_8PD$D$ D$tD$4$#v}FOUЉMЍJ})E„E"@EO 9B V L$D$$^UPFM%_D ȉFG%}XD$U4$cOUFMЉUE&O}D$뾍t&}D$릍t& OE@A%_DFEUЁ DEuxN t8R t/t AEفfN N $}HP G @G F P HN b&UЁQBEԋM9H RT$G D$F U$UPV @E tEtRPEЅFMЁ3 NGD$V<$tRP T$@D$VD$4$D$ &NG%f_V:G%t& V Dy t1t BEځfV V $=A @FvE0_VE%3 ЉFEt RPE 6G%v4$D$Ƌd' Bf%f=mD$Ht$$Bf4$H9v}t&|$4$G%+fE$KD$$ "G%t& W J Ѓ :G Et@MԋIPMуMt"P$V @B$F p PPE }F EEЃ}} eMЉ $]E} MԋUЉ }t%MˋPʉUu$R;t MЉH} }tUċBdBG8vE}FU&} EԋHWUЁ_V4$MԉU4$L$VUEqgQ \dtRff%=ED$4$EV%_Ft 4$F"F D$4$뻋FM<D$4$OFMt&W BẺ4$D$WFUvD$vU<$OU9ЉEC%=1Ẽ "} } Uԉ$];}  Eԉ$0;v4$HG%MvMD$4$yEMvED$"D$<$aE&} @gG F R P RPfG_W$G @ @gE$|D$4$4$XVc4$HFUЃ E%GfD$D$ |$4$gE% GG%F F$j9N$ 9f;v}D$<${vBE"t&vD$ D$<$9N tE4$E@ $F G%AE Jt$|$$Jt$|$$pWF EPUpF EˀPU^F E@HMLF E PU:F EHM(EЋEAMĉ $,MЋ9UF x x$@=tMԋ@=U$U@<%EMԋ@=F @ DƋ@EA u@ EA MD[E}HJDȋEUL$$D$ ED$U}u2MA ZMԋ@E̋I ẺL$t$$D$ #F @ H$$|PBR:$|P:%|P:Q@:AMD$D$ D$It$ $$_Pсt$ I;t PPPE $U)U$EML$$LU@<%EE1$x PtBt0BtF @F @ `$F ݉$SЍHt$$OHt$$=F x 4$U@E̋Eԉ$2U9E'U(uu]}1  tG~tg8tKtGGD$t$<$^]u}]Í&諏빍&LKD$$&U(]f u}0tFFED$4$D$x;|$54N]u}]Ðt&ˎ{t&U8uu]}0Ý FtdF%~ QFF A B9A T$|$F $tV @<$FF%= a=t]u}]Ðt&P$JNjH@IH@EIHH I H @ F% EFG0 GGGG<$y:t&$d9xD${$t&E 4$D$t&@D$F U$F @A U>UD$4$UWE䍃ffD$ED$ t$$N tF P 4$t<b@t$fBJ98yxyxy x yxyxIHz$9J$F0FED$4$D$`v<$pvx2&@ J P L$xj$EщUUU'UWVS\}u  G9t% = KZ ЉMMaMAE9 M؋OME؉EE0 GKt$$:f GE@@E؋ɉMMM؉MD$D$E$UMUAM)MEMAtPIEЈMɉM؋MA8Es +EE)EЋEE؉$EԋME؉L$D$UUȃTuuNuMԍ\[^_]Ðt&Wᐍt&OMu}w^t&E(Evw3wuE0Eht&Wᐍt&OM ME7t&O M܍4[M4[E0MD$<$U=Ut&D$EM@EE$UUȉEA& EM؋EM܋M؉MD$D$E܉$UMAM) UO%_Go G@ E8uԋFANHF uGMQ \[^_]ÍG@\[^_]Ít&E܉G MvG ݍ&@XfA @G% @Gu>*@ID$ D$D$ $UOƋh$fF Uȋ@t@A@,<f<$U%GU{UȉXUȉEFUȉ7UȉEtKt$T$$D$<$U+t$ UȉT$D$H$U]9æ u0t=tFFE4$D$]u]Ð[Ǎ&U]6 uu$fHp ]u] USEx @$7[]É'UWVS\uFó VwVt7ыF tP҉PuVV\[^_]ÍuPG N% ZFB@:t$\[^_]Ív$@4$E̋@}ȉEt&ED$DUԉ$B<uB @f%f=4$EЁH|P [BB@EE+MA@ EM@ ẺM@E |U+U` ; U+MEЋUA<$D$-|@ +QR  I | I M̉ fUЋBMЃA~Vt@;EF}ȅ<8E@ 6MԋP A DD$K$Wt&P(T9@$PRtB~B}@$ @$t&F ;0uVtN AE)F tGF rCP҉P'$NV @ PF% = $NNV@tP҉P%fAt(g&$`.v4$v\;0#4$N;fPtEUU9t4@Eӭ9Et"@E9EtD$4$P$t@M@u $%@$@4$@<$@D$4$ v90P4$*4$袬NkfuF@@Ht4$#F%@=@@P҉P$Qt&B \[^_]Ív$ V~t@$fP҉P$t&$vR,BB$FD$UT$$EnbB ?}Љ<$軪FуVw$v$航v% F P u-Ht&t@ tJ P Tt$4$ @t$/F @*tt& $`{v$NvAEtt&N aD$)$ |‹BP z$m$`\$SF,$C$@$v@tx t*zT$$胫$1@ @t̋@ uvUuu] F t ;tX;xtP;tH;|t@4$ Nu&FFu 0t(]u]ÐF]u] Uuu]` tZFucFuI:u>t ;t;xtw;to;|tg$;u7&]u]ÍFu4$]u]Ít&Kt$D$$봍t&F Uuu]ÀVF tzfF Ptt8҉Pt]u]Ít&E t2@$S]u]Ð$Ц]u]Í$Ȳ밍fF 듐UWVS,E Vp @9v.t&ȃ 9rl>tGuÉ_G Ou"%@Gt<$UU량<$UOUːt&U BtBt$,1[^_]fE $襥,1[^_]Ív$,1[^_]ÉD$(L$UWVSE&Óx8w t&7trF ;E uFt@t t$U$ЋFtV gtN ~Z$F tFtPtV҉Ptd4$7uUpBuU1[^_]Ívt[wu딍$t&k4$륐$4$뒍$ 1[^_]ÍPtD҉P9$,UB%p ЋUBH$ݣUS E;t";tPHt҉Pt[]Ð$舣[]f$[]Ív'UVSE'ÔP t) t-A t'HPHtL҉PtZ[^]ÍvJtA űJtA uH t>RtB uč$t&Ӣ[^]Ít&$0[^]ÐrtF k믍'Uuu]SF @ t1VсtZVF Pt҉Pt$]u]f$0]u]Í$]u]Í){fF 뭉'UWVS<} EEEEuF|t&Uԉt& ȉ 19u 1Љ‰U0tFFD$4$U؀}T$DljD$Eԉ$ F x@ FD V}t D)FU9Ut Eԉ$<[^_]ÍvUE߉D$E}ED$$讝}EvrƐ.t&'UWVS,}6ãU UD$$ƋHpU9tuf}qVUEM҈F N tEL$$FE<$FG tG,[^_]Ív}:t}#tz BN }qVuwmB cB t x 19H$虷:v}t&tvEFPvUD$<$Ut&B 989xf9x9x9xt&;x/vMAN@ J@Dt&UX}}]u1^Gu_PUG MT$L$$VEF F U F]u}]fD$o<$t@t ; t$GmED$"D$<$LUYt&tFF E 1oUD$D$D$ D$oD$<$SUԉU8]Æu}8E1EtED$E$=Ƌ} 1EtED$E $t=Mt6t$Ut9ʉF9(t|E#&u&E D$E$]u}]Í&MtӸfUx]MuƉ}@Èu_:ER:+wuGt>W ŰW uA9GuŰu 7E]u}]ÍvE O捶uE)ƉuЉm)9ȉuEmЉUEmɋuEE)Ήu؉m)։)‰uEmȉU1EUmm1GUűE  F @F ȉD$F UȉMĉ$\UȋM;E $ERUEċU t$ D$PLT$$t&9ًu)EE))ʉum؉U1Em؉MEmʉUm7E GỦ '&U Wủ<,UȉMD$D$D$ D$wD$4$Uȉ@ :Mefu)EE)Ήu؉)m1҉uEmɉU1mMUmQt&ëtmF ~@EV 8tPF1ɩEE$MЉD$衷MEu y ]u}]ÐE$ЉD$gۍvED$"D$4$9of4$묍t&UD$w4$]UЅtt@ Eti}Ԁ8oE$ЉD$9VEЉ$ݯEЉt$ D$EԉD$M$$t&FEt&}vD$w4$躹,D$D$D$wD$ D$4$螼 U8}}]uuMúGt.gt$d9 tft Bvutty~vLDMt$$*fPtމt$<$Ӹt΃t]u}]ÍvXt&<vgt&]v<wUEt$<$T$U D$T$D$ s@ f</t&"xD${$ZfH gHEUD$ t$D$E T$<$D$Ot&UD$ E t$<$T$UD$T$ú΋Ƌ뾋\붋h뮋릋랋\떋뎋,놋{pteZODd9.l#, hUEt$<$T$U D$0T$D$ 螹1UD$ E t$<$T$UD$T$gt~VLlt&DLPE 뙍'UH}}]uMG< uy$ `D$D$ D$<D$<$PP;P |T$4$藤PN PE ]u}]ÍD$<<$@op룍v<$t&#0uD$<<$E Ut.p@@UD$<<$U2EU$ `ƃ@U2&U(uu]}F<t\„u@%=tM~ t$<$趍NtGtTGt:]u}]ÍvV B뛐)ID$$ 蒈Ɖ<$蘧뼍<$묍 I$UWVSLE/ RUԋRUF<*_V΀Vt t$$躌ED$ 4$D$EԃD$ٜNG 3H …HE$|@P@:$|uB:%|uB:At&4$V%_F̀F`G $hF G8Pсt$ I;t PPP}Mԅt $L[^_]Í@tPn҉PPW BG @ F tP u@vEt&P t5F 5V BE+؁fF F $F @ @F<D$ 4$HF<$蘼088D$D$ D$tD$4$mt&4$8F14$(VTB:AEEԉE$PW $Ѕv$̡Q&F BEt&UHuu]}PýF<~ @ 9E vK} U uH$U=N UɉMԉHɉM~ P ]u}]Ðt&tT$<$UUNj~ P ʍD$4$x~ @ WvD$4$F!4$訿~ ‰E@ 9E nM +JU M JU 9ʉF‰D$EԉU<$D$諯U'D${$!'UHuu]}} *F% =t!1F @u]u}]Ít&F v$@ uG tˋE $! UԋE;}+ ʋM)ƒ Px)ЃrB6D$$"@ tmRUx F 9t)U9Q T$|$$UP;~{VF N &UD$"T$$ٽ냐t&T$$D$ t&MD$D$$MЋ)ƒD$D$$ŠMT$4$QUF 辻 EЋUkvU(]y}}u0t_tFFu]u}]ÍvD$4$9x sԉ|$4$袭sSƐ뤍&'UWVS,uֽCIVƒ  ( v FtMD$ D$<$L$貯P9O Njp 9uFЃ %=  sc Iс5E0F U @ DƋM @E,[^_]ÍvU 1M,[^_]Ít&сdD$ E4$D$NjU:G_% NG U @ DNjMG P u @?蕳$|$D$ D$$EjED$$D$oD$$E踷D$ D$U$T$9dG x u @F<upMt$$bfG H ,1[^_]à  4$|4$|V4E ,1[^_]Ðt&w Fvt&UM RCI$E U1M 1C$艰@F @&UWVS,}ÃU G w Ft_ 3t9<t t(@tHɉH2F& <Ftt~vmBPTuxG uF @u,[^_]fG `F @tD$~4$04$`,[^_]ÍD$4$UUxt&D$$@pG Hg$U{FUfD$4$UyFUfD$U4$耦Pv$UfFUM$芮xD${$rv'UWVSÉH9O  T$D$F $nUPV EFADF08,8D$D$ D$tD$4$$&@4$D$ƋdBf%f=mD$4Nt$$9UD$4$kFUXfUԉL$4$iEUUD$4$蕈Ut&UD$4$wFU$o^ f!dBf%f=mtDF  E4$D$ED$̃F%DF}E} 9v.O9J )F T$D$$8rx08t8YE+EEMЋBT9Q V UԋME}ԍ9s&9Lj rED$UT$}} <$5MHF @\[^_]ÍvRUvV M E< EċA9EĉE)щMԋM+M9ME~!L$Eĉ<$D$UȉM蠐M̋U)׉xF @a4$\[^_]Ít&T$4$dEԋ@&D$D$ D$tD$4$HzvL$4$E)t&ED$UT$E F $F @Yt&MԅuH}t-}+}4$|$aUT$M<$L$袏Eĉ4$D$`M+MEԉ+}ԉT$D$<$Mh|$4$`EM̅UT$E $D$8ED$E<$D$UȉMM}UL^I$蛖O$荖t&UHuu]}} -ÚV <$UV~UEU9P T$|$F $sUPF%DF08t:8t/D$D$ D$tD$4$?&]u}]ÍvD$4$`V<%_FtÉ4$胝빐T$U4$U3D$4$} t&'U]E SuuD$4$oF @t4$]u] UHuu]M }}芞F ~G9B V $U|$L$ڌU:xF%DF08t58t*D$D$ D$tD$4$袜f]u}]ÍvMD$4$^MBF_Vt4$볍vMD$4$!M*&MD$4$M|M$O$臓 U8]U&ÓT$U eE1EuuD$$Z,U4$)‰D$T$}}Ee3u ]u]v'U]E 覜uuD$4$F @t4$]u] U]E V÷uuD$4$zUT$U$T$|]u]Ðt&U] vu0tEtFFE 4$D$ED$^|]u]f#1 UHuu]胛}FG~T - tBB$UD$yFUԉz NH@ J D BvD7t D)J]u}]Í&D$<$,NDtԁJ ˍ&EE<$D$jƋE4$D$H lj4$輑댋tL t@@ZF$oD/vs/v뷍&'U]ٙFuu 1]u]Ð@up tx؋H ~э4u 9vt09Pu;t;|t@xt$k$h돃끋@$s{sU8]U&Ó}} u0t\tFFut$U(wUlj|$4$T$cy]u}]Ít&U .U뢉'U(]艘uu}8tGGE <$D$ED$x wt"x;}<]u}]$lѐt&S-ǐut&'UWVSeE1詗F t$@ V @9‰E EM܉ƉEMD&  \vB \F0;usQ9Uv_ y)UMpUMDx@uMF- u\Fn;ur9Uv.F.F.udPBf%f=m$8D$ TOt$D$$ 2vEe3#Ĝ[^_]Í&\Fr\FfUpUEMwDx@tf\F\OFv@^pvw @ᐍ|D$D$$Bt$D$ D$ $&$xMMoIt$D$$ ubfU8])ÖuƉ}xxfD$ t$f$UD$p ~$ 赐Ut]u}]Í'UE]薔uuD$E 4$D$uF @t4$}]u]Ð&U(}}]Cðuut,E 4$D$r|$$yV]u}]fD$4$D$sF @tω4$ }ōU]E Ɠ3uuD$D$4$sF @t4$|]u]Í&UWVSLuv} 9&F @EV U̅G \@E܋W UЋMu7EE91Uԅt Uԉ$YL[^_]Í&EtЋVU3W h$B V,E ỦL$$ ‹$UĉD$7aUB b@EJ M̋M9Et(BfB151ҋEо9Etủ9BB$st&ED$"D$<$qEЋEED$"D$4$IEP|1EMQ&$TXvE>v|EEvF t}HMF VL$$ T$蛍t&MЉD$ $a‹$UĉD$_UB HM܋B EЋERvED$"D$4$AMo$1rEF ED$ED$Ẻ$P;EtẺEԀ} MEE܉$UD$"D$ɎM܋UĉEЋEE$UD$"D$螎M܋UĉE̋E$1SUЍED$E܉D$$O;EdEЉEY'UHuu]U }|F@ @ tf߸]u}]ÍvItۉ t6}@EF Uԉ|$$fUԅt1UP듍&}UD$|$4$膍U븄pdtVBf%f=mt=8D$I$ЄUD$4$OFUF$qčI$蘄U(]Iöuu}} D$4$|$n4$D${@F ]u}]Ðt&U(uu]}MF @u]u}]ÍvD$4$zu1؋~ @<$D$aPtF B9r몍&9v?yN 뎍U(]Iöuu}} D$4$ztV݃<[S$ 1ɉGPMԉUmd^FtF F1@t&@uK%=iu`82d]u}]Í&x tUT$@D$F $|ǃh~FV Ẻ$^{E̅F€2V݃<[T݃ 2FBF FuBf18t&$XiG@uzFtF11FD$$dV=$)|fuNVƒ :t&D$4$Hd4$u먍D$4$dvF<FuzEB1'v$UEhỦB@N$ v苀Av2vUw[ډP1$U,|U1ɉBPMԉUmztSF$D$4$"cF<vPU%1ɀ2FMԉUm@1+FFB1N D$4$bF뛉'UVS u觃UF |@ @tl  <„$)4$Ws1E  f@t J F @ tXD$ D$ 4$D$tOHt@ ;F t@ ft+@ [^]Í&4$`DFWftʃ 1[^]Ít&$efED$BD$F $wƒtUtF $v$Nes$ }ftՉ̐t&D$$v=vtDEx(V BKD$4$BFE=YfF vUWVS,E6ã@ UB }M A 8x$Jo ;+ )U GW)ƒUUHP)ȃEQAMU$kUE)ЃsEzU$jOUB)EwD$D$E$|GI21D$$7g9t#PtaR^E@ t[@U9;~Ro],[^_]Ðt&pE@ uMD$ $s땐t&D$D$$a&|$<$D$`Nj)R|$<$D$`7fT$$D$`rt&L$ $D$`&t&|$<$D$t`Vt&t3 ft$@ 80t&$(w{1s3{UxO$>tU8uu]}P}F  t` Bt$d9t,~ G -D$4$J|$4$?F0 @/%D@D$4$[@V%_Ft 4$6{FFt&]u}]D$4$ qF&zt%_NNj뛍vكH[\$4$`كL[V%_Fu_"أ/FJf4$>FKJuo_NNB&]؉4$zFE뎐t&T$O]؉D$$.3>EOvߩNf4$yND$4$\~'dv1Dž\wDždTJ A4$BlLPMp P)9/DždlH Lt` $jVL\Phfrh֋t f8pu≍thvlt+F 9rtX)9vPdP\PPh`LL$t$<$>\tlt+F AL{%=`$"2tD}@p@D9t|9@pl)Ƌ9p vt$<$)Wet&B% = D$$MXPPP~9PlLNȉD$<$VMDždLsD$D$4$ZED$D$4$qcFhtT$Lt$<$&DL։t1҉hdtTlt+p ‹pP BEd9ldw DždthT$`D$$Y` $fF`4$\>4$LRL\hlt+w pL9H rsl\p t3\8p uvhtt&lD$ $TLL$<$TLpD$ $F@tVB 8tJG u_O$v"@G t08B Ht $b/B @f@ ty H LL$F#;*O D$:$Ot H P 9s` 9w}e3=\[^_]v9So9H d<$_O9D$D$ D$tD$<$_D$<$I.U $`|t$|$d8r qu8$t$|$]Ëdq8@U8]9`æ{}u2F uc)ЃAEI1tU4$EU9Exd]u}]Ít&UD$P4$MUt)Ѓ~]BUEL$4$8UBEd또T$$D$LA=t&^t&T$$MD$AM녍v'U(]^fzu}dBf%f=mt5D$X[|$$f%]u}]Ðt&$%ʍ&'U(]uƉ}@n^yЃ ti tDu}%FF$BD$lj$"=Ow ]u}]Ð@uxE%FF붍&z(yuz u1r$uf4$2냍t&4$ 8F뮍v4$%Ít&U8]]y}u7$EEHƒ vd]7u}]fڍ&U])]Öx}u7d7]u}]ÍU8]\Fxu}d 7Att-tU>Ut 7]u}]Ðt&)~ ft$4$UD$I>Uэv'UWVS,\Ùw8w@  @E}U~B q @EJ M̋UB t$B EEE+ẺEEd Eĉt@EEt:EEt'EEtg=EEh xv}}̅~}B$ t `'}j B$@ F$jP R҉U}}>D$E$7U$'}G 1 MA@uC @%AHx-uuV <uuD$(}|$$4+2|pM|Q @ M@E|EDžlEDžp%B$@ F$EEDžlEDžp| t4$JSu}z$M"MTEĈMMEE@EEE}̍t&mtD}(;us5>  <$ReU)9^}u"|U+d+h)‰Ut9MA;uU}hux;1pl u1OeBD$$>J5}?}N dMP 4L$4$pF @wE}dw[^_]ËB$ẺEȉD$M̉ $uAEE;}? d}EăEE9EEĀ}E-U447;u}Ȑt&> t4$PU9rM@$ ;u< X < P < vE < = < 5 U#v< ,< $< < 9< u΀}t&E% E4$D$)D$RƋ+EEE0}Mw@$ ;u /Mȋ f9DB u;u&.Mȋ f9DB t;}t&;uȐt&JUȍ&< vt< t< t< t&t< 9r t&D$ML$ $A6EEP}fuFE% ED$Eȉ4$)D$PƋ+EEE0E'&mUE}EtX9 8 uv> t&t9r9s(}t2MăEE9EMĉMămuU@M M$L$)L$`O`E̋)Ѓ~=Ẽ뙍&}du1[^_]ÉT$$D$4뫉$ UM]$0ED$"D$E$QE̋ExD$$FE<=]$ ut5`+`t&DA uP< t< t< t< t< t捶%GMMMA9EB8EE;uȉt UU Ű}EMEщDD}@D$D$UL$ D$T$}ȉt$|$U$\P\?DxUP$tUP$txT9t)΋Mȍ47)э MȋPPT }MKUăE9DʉMăx8DTU)MăE;UDуU9p8|SHP MJ}u9}r9ZM+Ẽ~EM̉U9p8}M̉D@PTTp9uZmBF4$t&8xD$P<$n=l ;||+)_ulFUEEDžp}u}Ut&t(tIu'Mu$``7Ɖ}U;uU}zu19}X+E9~|$ML$ $00E}EOEE E%EăE9־Du;Uփ}uËẺ4$D$)D$`\BJEu\``B8BU$P ME̋@,ETEEU;um ML$ }̉|$Eȉ4$D$I}EăEE9EEĉEĀ}E<$D$"녍&E% ED$+UT$M $IM‹+ẼD$ẺD$$`H.`EWfE% ED$Ẻ4$)D$HƋ+D~"DD0UHPTnD$DL$ $-D뼉t$4$D$-MA @}J+E9ECE1҉UԉEm؃tz݃|z@}uEW t$T$$(du0D$}|$<$,E)9EE~A1fD$t$U$.tMT9uҋu MEd[^_]ËDUUD}GDM9U)UD$ $7@ @EGEDžlEDžp|E;u}uD$4$/F}t$``EE묋}> $2EF}<$G$GE|$<$D$4+E[UT$ML$ $+Eu+E;EED$UT$$*EE% E4$D$)D$BEƋ+ED$ML$ $y*EEE0#A }G vG EEẺumt U8tI;}ruD${$*>EEE}t^UăEE9EUĉUĀ}t4E<$D$kD$"D$Ẻ$&F2EAU U$T$)‰T$C‹)"t$4$D$`)`ƃXt&'U(]FVbu}2E䋃 88d@tKtE A9s$qƋ2]u}]Í6qލ&U܉MDMU܃ UWVS,FÙaL 0Uԋ dMԋP7„tM@cUԃ9v#& 8:9rd1L[^_]Ít&H yD$4$VnƍF9s M8 Mȃ9r뜐/6uF+uЋV qI 9at&129rduԋpO T9s"t&M2MЃ 9rG%DGuԃ@ucEԋdxt&BdED$D$<$#UdGuԃ@t<$,듍vt$ uԉ<$D$t$ Gv 'EF [Eu14$EfMЉ|$ $1?EЉt$$?f9}uED$|$$&UЋ$D$t$E&MȋL$D$E̋Eĉ$z"ŰMȉT$ $EċỦD$$qEЉt$$q>mUD$|$$ D$t$‹MЉU $&UT$$$)=GvUt&#tE94$ >$뙉'UWVS,@Ù[< U܋04dP VEFE@ })UȉM̉D$<$4UȋM9vEu1։M}؃$W|$}U؉<$D$9uwҋuЍ&d+u܋0BtAE@ U@}D$<$G @Ed0<[^_]ÍvUȉMD$P$,UȋM̅@F;te+A6SBD$$%v <$t&'I$2M`;M댐U$;$e M\t&U8] >vY}udp@f%f=t{$U.U)~4B @t $M MdFN]u}]Ðt$4$UMD$nMU먍t&$UE U냍UWVS<=éX< E܋U؋M؋U䋓dMP UEqF u{z9}fr[$%t$ED$T$EԉD$@4$D$9}sEfUD$P4$M*Uԅg@UB;U+U܉3eBD$$F#d}䋋+}؋9Bt6F uV@UD$$MA @u&Ed8<[^_]Ít& $$Ѝ4$/륍vk8'v4$8$p v4$`$vUWVS ;yVL E䋃0x9xE|$J}܉M؋@ id})@4tZ@ @+M8I9M؋U܉E܋dL[^_]Ít&huE9UM*@+M8I9}y>9urV@ uD$$.t&U܉_M؋EuEЉ9uEsuԋU2dL[^_]ÉU7Ũf,cD$D$D$ |$D$@,$U ,U@ tWD$D$D$ |$D$@,$+Ű@EE܃gt&D$D$D$ |$D$@,$U+D$$,ỦED$$,vU܃t&UWVS,8ÙS,0 :d9@tCW9GU?GUd,[^_]Í&) x; |$* 9r9sd0,[^_]ÍGg5v6t&'UWVS 7yRl 02E؋FVE@ MJ9MM]U܋P UԋPE9U+U+UЉUU+UU+UԉUċU̅t8M܋A@u E̋}ȉuƐ$. uuE+uMEtVE1҉UEm؃tz݃|z }<$'U܉E؋EB |$D$M؉ $\Uąt^E9EM܋UP;P =P}t4M܋Uxy Mĉuĉ)ȉ144uuċM̅tKE1҉UEm؃tz݃|z U܋EB UT$Mȉ$L$<d8@Y;UEUԋEԉU1҉EUm؃tz݃|zT ED$M؉<$L$E@ @tCUx;Eԉ}܉uԉƍ&${u}܋uԋMЍ|U؉$~+9l[^_]fD$P$UM!UM@!F;+20W+dPtt tD$X]$dl[^_]ËB@ x$1ҋ@ )щMЋEЅEE9EH‹U@ @Eԋ}ԅM܋P7M/MU܉$m0$Mt&EԅMԋU؃UB @I$MEԋU؋M}܉uԍDω҉P&tPu׉$Gېt&U܋z +J9MQEЅqMًE܍ H MJ U܋HoM܋P UԋP &jv,cT$D$D$D$ D$@,$UMe$UM@ GT$D$D$D$ D$@,$$$Pf[D$$ M܋PUN&UEHAD$E܉$ E"t&}EtME1҉UEm؃tz݃|z+}<$!E؉|$EȉD$U؉$ <d9@;)9EGE1҉UEm؃tz݃|zEЋM܋UA T$D$<$U E@ @tLUx;BMԅt,Eԉ}ȉu։ǐt&$u}ȋuMԍ|M܋UċPM9MUЅhMċEًP MԋMԍ M܉A MH MэfuE̅E1҉UEm؃tz݃|zU܋EB UT$M؉$L$> E؉$%p,vvD$$"U܋@DE)t&UtQE1ҋH EUEm؃tz݃|zEԋUED$T$Uč$M܋@Q MԋEЍTM܋A A @`$E܋Mԋ@ ɉEAUЉ}ȉu΍҉Pt{tPuۉ$ېT$E܉$i U܋UP$t&+vD$$[!E$vuU܋P+MMԹIMԉM5E܋MċP EىMԅEЉ}TщMȉ}1uf44uM܋}uȋQ SE1҉UEm؃tz݃|zMċEЉ|$<$D$ME܋Mx >|$$}܋uT$D$D$D$ D$@,$D$$ Mԉ+|$L$E$U U<:|}ȋu $ Uԉ$Uԉ$D${$i!UWVS+ÉFL8 U؋u؋ $ M#;}܉Eu܍F$EV9vgD$$EԉT$ EԋUD$D$D$ED$D$ D$T$$"9w^t&[}T$E$ EԋUD$D$D$D$D$ D$|$$N"E܋+E؋)ƒ~6dxxx;U$8L[^_]Ít&D$D$$ 봋E$GE뵍v'UWVS\)D,: 1 4)V)T$$I‹0)~0dxx?$'2,[^_]Ðt$4$UD$ Uf$x뵍UWVS(C\Eċ Uu EċUč MdEԋU@ uG@Eu tCMA Q1fdv@Eu1}9}ҋE"EˉÜEE1UMD$؃T$ $D$D$D$D$ D$M܅PEty9}t]E@ tMP A Tt z }dM@t$L$D$ E$ Et9}}EMED$D$D$D$D$ D$L$$Et&UMT$ $fqU䋋T$ $d@tWt%E+E9EԍPw,HUԋUԋd\[^_]ÍvuċN3$뢐UD$P $Utb@@ ptK7UD$D$4$ Ut&U D$D$4$ U2EUD$E$-UAt&d@$D$[d@Eu4$"$ U(v'UX]$@u}d7@@NM̉UЍVUԋVUJ  t;_]$EԋMԉQd]u}]fxy͋MA @D$$< tEԋxfED$ED$ D$$xxd7x&MD$D$D$D$D$ D$L$$ xdFẺ t&Etx t f@ Pt@ u䋃xd7ED$$-U'UWVS")>ldEԋPH5Et&sEdPE@ u}1 7+}UċUԃ Q  _]$uЅ}ċu>\fE@EvuԉvV  _]$0MЅu>dl[^_]Ít&dPEExD99}̉3t&@MЉD$<$L$hD9u@ uD$$뼍&}HEċU9MԍxQP$fx[$(v9EЉ}̉σ@E&UD$D$D$T$D$ D$<$D$sD9us}A &@MЉD$4$L$FTI@Et,Et EtdEȋP@EԋUԋփEЋzGE% E dx[$}䐍t&M}tEd2vED$D$D$@D$D$ D$L$4$t& Mԋu}2U7+EM̉UЋBEE%  dx}i}u EM9(}ԍpWPvxPa&D$ $v_]$R}f_]$:gD$P$s EċGED$P$L @;@ x7D$D$<$_U D$D$<$=oMЋAED$P<$ EԋGD$P<$ @|@ P7$UD$D$UU D$D$$Gҹk}{EЈMD$D$D$D$D$ D$D$<$/M@EMЍED$ D$<$L$W}E$NjE$}]EE&9u6}>E$}EЈUD$D$D$D$D$ D$|$$PU@EEUD$ |$D$$x}E9uIzMЈUD$D$D$@D$D$ D$|$ $UEi@`MЉ|$ $9>t&MD$D$D$D$D$ D$|$ $9&E$E$0KuU2D$E<$fG }D$E<$c/GEE@ HE}IL$MD$<$0ME}ED$ D$L$<$}/?pPEEЉ<$D$}UЈMD$D$D$@D$D$ D$T$<$ME@EE9u@ x}E}toEЈUD$|$$Ut}EttEUD$ |$D$$}E9uopMЈUD$|$ $UEt@덐t&MЉ|$ $> MЉ|$ $m)D$$f E$4E$w<$L$F}L$MD$<$7ME@MD$D$D$L$D$D$ D$<$LL$M<$MEEЈUD$$ UUЋBEG1<$$CoUЉ$$+&'UWVS91\Eԋ Uȋuȋ EԋUԍ dEMU@ C@)EEx 9$E@ 4dxEEEE؋U9U׉ut&p~+u}ZEUE܉t$T$$‹EtGw9i}t+}9t$u܉T$UD$ 4${UҋEt9}rI@ aD$$Of fEEx d@t[t%E+Eȃ9EPw0HU䋃dU\[^_]Í&uԋNv뛍uF EU:U9U։Us;t&@9L9ur%@ uD$$9L9usۋu܋E9x |$4$3Ef,cD$D$D$ |$D$@,$@ D$D$D$ |$D$@,$@EOv}E܉t$$E&E܉Ut$$UUt$$UzvD$D$D$ |$D$@,$D$$/E&D$P4$tS@tU@ pt@7D$D$4$ t"U D$D$4$ E4$t&$딋EEE UWVSÉ,,d7E@Et EtEtEE7D$$7‹)~Qt-$UU܃}tTd7,[^_]Ã}u拓FVd؉t$4$UD$9U܉fT$U7$rB둍'UWVSd+<0U䋓d@NjE$E1$$E@ 9U)9dPffM1xcED$|$$.t9}}(U$Cd2<[^_]Ít&E$dP 뗐t&<$卶t$4$T$8,cD$D$D$ |$D$@,U܉$U@ t?|$D$D$D$ D$@,$xKt&|$D$D$D$ D$@,$D$$U9׉U3|$$9}}g'UWVS Ä(<JMdE܋@tftft UU؉ƋE܉$UljȃME܉$U9E~2KEd<[^_]Í+E$1ҋ@ uLU؋}MAUU$T$~d9<[^_]Ív,cT$D$D$D$ D$@,$UU@ T$D$D$D$ D$@,$P4D$ML$ $a$1҉E@ Mt&d<[^_]ÍD$ED$U܉$}tTvT$D$D$D$ D$@,$D$$\~t&'UWVS| %LdEԋuԋP <B @EB EċG߉OMe<t uЋ9p B G $B uĉ};t&Jv JvJЀ v_t \fmMiy<:9G)Mt1Ґt&  9u븍t&QɉUtHuJv"JvJЀ v_t \t&UJ҉Mu+G BG%DG@t<$Eԋd8L[^_]Í&uD$<$t$AG믍t&E$UD$"D$.ỦE=vỦt$<$MUSUD$<$-MUf}ЁO 'UWVS y#lEċUԋB .uԋV.d<MJ Mԋ@Eq EЀzpM9H Bz B%_DBEĉMŰUB $@  9ΉMMEىMEȐt&M4$L$EԋEȉD$E9Es1MEЋU)UЋM9J sE+x L$$ZŰEz Mȉ<$D$L$>}u9uwúN +~ xMA @t $EċUl[^_]Ívtn$ MЋ@ 08C;us8}ȉu‰׍v09EwuMЋ})ϋE9ETŰ+z xA&$MԋAt& t$B % =MԍED$D$ $MNjEԍqduЉẺU$UL$U&$UD$Uut&U$)U|EE3t&uԋN AvuԍEUD$ D$4$+UƋEE% =;uq}}ȉut&xp FƋu9UЉuw܋uMЋ}),fV B -_Eԉ$%Ut&ED$D$ D$tD$$m;u}ȋ}Љuf@9wfUԋHMz t&UWVSLùeE1U MċA 8MċQ8d<UJ  Mċ@EЃq EzM9H dz B%_DBEMЉUUB $@  9ΉMM̍E։ME&M4$L$EċED$E9Es1MEU)UM9J sE+x L$$UEz M<$D$L$n}u9uwuN +~ xuF @t4$UMue35YČ[^_]Åtn$ M@ 08S;us8}uE}09EwuM})ϋM9MD+y x4f $uċFt&f t&$R % =EЉD$ED$$MЉNjučQdUuEf$UL$U&$UD$USt&U$)U|EEt&uċN AvučEЉUD$ D$4$;UƋEЃE% =;uau}}t&xpFƋu9Uuw܋uM})fQ B  GEĉ$5Ut&ED$D$ D$tD$$}};utUt&9u<u>U+z }ЋxE$MD$)DD$ UMEЉz >G9uw!&;u y<ƒ?ȀGƐ$B 'E9P s$E+x T$UM$;EMUx SSuċHMЋ~ t&t#t-G<GSGSGExt&UWVS ydE0xFf <„6@EN MċVс  E $HzEMR M}EESEdP <M;H -W G1%_DGE8}7E$@ t08|EՈ$ A UčED$$y=E܉D$EՉD$Eĉ$R}UME9EȋEMЃ)E@$)|EEFEE% = E}F% =@EF }‰EĉE}<EՋMMEֈBučB9v-}ĉύ&D$$T$9w}+G AG G@t<$bM dĜ[^_]f4$F< V BvED$D$4$!t&EF tO GbvEEED$ D$4$EċE UEPHFE@EՉEE܉$UMD$ED$E܋UMTCvD$<$M;H L$<$f&uăED$t$$G $@EG Wuy D$Eԉ$3UB @)t$4$D$ƋUԍFVd<[^_]Í t$B tJMЉ<$g$诿MЉNj<$D$W H$B 6vD$ iD$D$ $vED$"D$<$t&$(t&'UWVS9 , U}2d4P G M@EG MG t$B dRfflItPMuvv t&t vt t t MuU؉T$ UT$UЉ$T$EtgME\$ $=E@ @ud)t$4$D$葵ƋUԍFVd<[^_]Ít&MԉD$ $虨E@ @t$舼뒍0u mxt,b1MЍU؉T$ UT$$L$,U؉T$ UT$UЉ$T$ ED$"EЉD$<$n=<$蠧$H D$$G t@EG UD$"<$T$t&U(]Iöu}d8P 4Ht P B tl@؉D$4$QF @uC7d8]u}]fD$D$4$ıF @tÍ4$볍D$$뇍t&D$ D$$T$tF :u\t&H-&'UWVSÉwdL[^_]ÐHMt H A XE}@EQfu t&@+E4$D$>F @E䋓d0L[^_]Ðt&P 4GEWt&D$$к}EQZA f@^MdE؋}1G@Q:G4$t&cMv4$P7vD$ $Hvx}t&'UWVS9Ld8P@UTOMwB J A }D$D$уL$ $護:dOB@u F ZD$D$4$M+MF @>wdL[^_]ÐHMt H A XE}@EQfu t&@E4$D$ކF @E䋓d0L[^_]Ðt&P 4GEWt&D$$p}EQZA f@^MdE؋}1G@Q:G4$t&Mv4$7vD$ $vx}t&'UWVSlED$ iUĉ)<$D$T$r}=vEEȃE9w‹MuEЃ$zEȉǐt&D$ iMĉL$Ẻ4$)D$u<$D$ЉD$w9ủwD$ EЉD$UȉT$Mԉ $UԋB B@t Mԉ $EUԋdL[^_]f@ЉD$Uԉ$詎MA @\UԋE&D$ D$64$D$v}MԋA 2Ad1L[^_]Ðt&D$4$xYEԉ$D$4$+E;&ED$ D$4$1t&$谩EЉǍvD$ iMĉL$Ẻ4$)D$HuЈ9uwD$ EȉD$UЉT$Mԉ $EUԋB%߉BDf $8v$($EEЉ됐D$D$ $ėE@ @uUԉE0F$̠ߋEԋP&UWVSl<0VUNA t[Q B tRD$ D$D$ $vBJd<[^_]ÍPt x G u@ttNQ‰׋PE:UTP@vD$$萪PvktkF@ touwzuFEd<[^_]Ð $D$(NQ$Pu$gF@ u$]SEtxfPRx/@9tfxFUdZvxFdM 4t&R;Pvv또&UWVSY<0VUNA t[Q B tRD$ D$D$ $BJd<[^_]ÍPt x G u@NQ‰׋PEׄ}_R;PoFdM䋓 b&D$$PvOtkF@ tos{FEd<[^_]Ðt& $D$舧NQPu$ǭF@ u$]賭Erx냋P}t:R9PvnFUdNvR;P떍@x'9Bw&xt&x됐&UWVS<é<0VUNA t[Q B tRD$ D$D$ $FBJd<[^_]ÍPt x G u@NQ‰׋PEׄ}_R;PoFdM䋓 d&D$$@PvOtkF@ toswFEd<[^_]Ív $D$ؤNQPu$F@ u$]ErxfP}t:Rxi9PsmFUdT&R;P딍@x9Bu&xx둍'UWVS茯<0VUNA t[Q B tRD$ D$D$ $薡BJd<[^_]ÍPt x G u@NQ‰׋PEׄ}_R;PoFdM䋓 b&D$$萢PvOtkF@ tow{FEd<[^_]Ðt& $D$(NQPu$gF@ u$]SEvx냋P}t:R9PrnFUdNvR;P떍@x'9Bw&xt&x됐&UWVSܬI<0VUNA t[Q B tRD$ D$D$ $BJd<[^_]ÍPt x G u@NQ‰׋PEׄ}_R;PoFdM䋓 d&D$$PvOtkF@ towwFEd<[^_]Ív $D$xNQPu$跥F@ u$]裥EvxfP}t:Rxi9PwmFUdT&R;P딍@x9Bu&xx둍'UWVS,Ùf<$t&z>벍&PUvUWVS,ÙLd0NP ~F 9uXCEċ@=E*Eċ@Eԉ4$؉D$MF @F4$t8vD$D$4$|kF @f4$tv$D$4$p`F @t4$btd79L[^_]Í~D$D$4$U{kD$UЉ4$T$Dpj&E$D$"D$UNUЉEvD$4$LF @+D$T$4$ljF% =u@EV EԀ8-D+ED$D$4$wjэt&'UWVSiLdP@Uquy@Ɓu܋B1EB @ }ЃE1}]D0E؋ED$ E؉t$$D$M{Mԅ2dNB@u G ;D$D$<$M,iMG @O~dL[^_]fF t F @ AE F B0d MA<fu uMEA@u@EF @U 3E؃}]<$EЉT$JG @<$sqp a$U%IUF R4$U IUԋB0DFJ fAa:t&J fAI,v<$t&oMvD$4$8j3vD$4$zvD$$jED$$zE1MBEY<$hoIt&'UWVS yu9Mv/Et&tb9rUЃ‰UEăL$|$  $D$jM M1&@If@IVvT$4$LeMt&BUą 9| ;ul_$kf$pmvD$$iD$$Xav+t$L$M $UWU EvE)E,_$kl_D${$jUWVSt ld8P@UOM؋wB J A }D$&D$уL$ $}f:dOB@u F  D$D$4$MSMF @wdl[^_]Ð@ t H A ]$E`Nj@uKtFt)%=@E1EEYvD$<$gGt&uEكP[EEM؋$]U_UNj@Eu 5u EvuLكP[كD[$]]5D}EE$]DEIz-.E8Et=7vـ}f}\$4$VF @Gdwl[^_]ÍP 4GE؋WKt&D$<$eGUEgA@1҉EEE;t&%=@EykEcT$$]c1EG}_&4$ZM$~h‹}؋Mԃt_1uԅtEM)8MEЀ}ډT$4$2F @q&4$Y]v]$U6Uf<$]UjUEQt&ɍ]$]]6EE&1ɉUMm\$4$OTfT$4$D&<$Xjev$]Ug1EEErt&ًE1҉UEmt&PEfUWVS[^_]Í&JtJ`@ @t$PG<uG @돍 9t&xD${$-UW1VSfW,E  dM䋋1uP uM9΋Ev)t&$J9urE+EЃEu܉|$4$(F @uV+EED$D$$/HEUM܋EJd,[^_]Ív4$8O렍&'U8]eFu}d8H 4U$J4$D$'UF @t 4$NU䋃78]u}]UWVS\eɀ,E؋ Uu d ωM9M؋P 4Ev)uu؃D$E$B9w苓u}+}F @<8uK)|$<$D$FljwdG,[^_]Í4$M뫍&'U8]Ydu}d8H 4U4$D$BUF @t 4$NMU䋃78]u}]Ð&U8]cFu}d0@@t`EGU$.5<$D$%G @t<$LF~du]}]Í&@uJ`B 8tQE䋃)yt$4$D$E^P EBfD$$@P@ 뚍vUWVSb9~\Eȋ0;7F5@E~F% =t*Uȋd\[^_]Ðt&t&`tPZ҉PF7F x}F E̅~D9L ɉUU1f=uU̍GE )}u!t&)lj9E}r4>yԋ}̉9ѐt&ED$D$4$`E%GI1ɉEЉMm؃tz݃|zULD$U$dKU f$$vuND$D$ D$gD$4$^_xvFٍ&ED$D$4$ _}E@]M$&MX&$AGPM$GQ EMEm؃tz݃|zw U$ QLUD${$U'UWVS_z<0~@ H vɍWutqu1A<vK)ЃT$$D$"A‰rBd<[^_]Á^捴&D$"D$$]_uԹ%bgMA 0svuԹ]7ut @ cUD$$ZU:fEԍ]0:]Ep:]Ep:AuF:AM@U$d0UfuԀ>OywMA @t&Eԍ7b0:7bKEp:8b6Ep:A$uF:AMA @)EԍG0:GEp:GEp:AuF:AE&uԹ ]uԹGyuF @Eԍ>b0:>bKEp:?b6Ep:A$uF:AMA x @!uԹ/bMA @U$YUƅU4$=+UUD$ $BIU@ 밍(\D$U$DMUA @뉐@ I D* UH]y[v}ud0@P tYRU@ taD$T$$PD$$0]u}]ÍvtH A uP\$Qt&t\T$E$ 7UE{t&UT$D$"$1YUT$@^P'&U8]IZöuu}d0>H tG u'0]u}]ÍD$G UM$0$ 8M|$ $D$J:MUA @u60뛍UM<$zGUM`t& $BMUU8]IYötu}d1x <@< uP)"t$4$UMD$:MUƍF~]u}]ÍUM<$jT$'MUUWVSX tLeE1UċB t@E}ẺD$ED$ D$$Nt$@ tD$RT$@ $TƋUċd2Ue3L[^_]fB ^Eh}ED$D$<$]@|0u\|$$DEċ%fdt&Pvt=%t܃Y=)t&=^^D1/&8<$D$ Rt(nR<$D$Qu$1ɋ% E1taE$^t&t}uMuD;Eуyw tD\ LփuUt P|$trDE։L$D$$RMċ^D$D$$R ^D$D$$RD_'UWV1SU'qLd8xx@f%ADED$Et$ D$UЉ$LUЅt~A< u^ ƀyx7>L[^_]ÍMɉMt I q9tLƋ@<uƍDUЉ$U밍t&$P$($U덍vAt[뇍vMԋHD$ MԋIL$MԃL$UЉ$oQUЅEw@ plutF t"UH]YTo}ud0@ t>$UIt&0]u}]Ðt&@B H$1B uȉ$?$"룍v,cD$D$D$ ED$D$B,M$FM@ ttUD$D$D$ T$$D$@,$JFM@^t&$F:U0U܅E䋓$D$D$D$ D$D$@,M$ED$$GMM$JMU܉$MD$D$ D$#T$-QMKt&'UWVSLRùmud@tGF<„A|U D$_t$$T$ V„tn@$)M)}t0@t"tV3BU1[^_]Ív@x E4$D$D$ "[^_]Ð u܋ED$4$D$!uD$4$qtUD$4$T$!{gV Bvvz U T$$S$)wL4$@}V B„IE D$$[&E(1[^_]Ð&UWVSPÉk<EEԋHE&F @ UD$ D$D$4$AUȅ MH59v x EԉuЉ;}uG d@ tH4`E8E<[^_]Ðt&EԉẺ%= tMԉUȉ $EԋU@ MԍED$ "bUD$D$ $%UȅEEM̋A 08d@ N4t&-^Uȉ$'dUȋ@ t& 9둍E0NKvUȉL$<$AU@f@t}E̅M̉Uȉ $UȉfMԋy G lEt&Eԋx Gt&~ :UD$ $:Uȋ@ 8EUȉ$ Uȉ3Ed'C$CD${$vC&'UWVSMÉhUЃ9fE؉t$4$D$, $(>Et&H5D${$@\$r@v'U8]JÆeu}dJ  )HMPHHum@t;t$Uf+Uu$Ut&E䋋]u}]Ít&M䋓 UD$D$$)+UDQ@ U$BU4fU&UuH+@t=u@UN&E䋋H"2vF뼍\$>'Ux]YHc}ud0xu8)FV]u}]ËB EEԃEvI}OE%_BE7@2뉍^ᐍt&t$4$D$l)@t&1:&$UAUȅtKD^EԀx<xH(MԋA @ DEԋ@H]UȉL$D$$ v Uȋ@($UȉEpUȋEċB(f$t&EE%=J @ EtIɉMفbJ J Uȉ $=UȋB @ BEI$ _t&$UD$UȋJM&9$L$$UȉMD$%UȋMB @$.M$.v$UCUȋBB EЋHɉMA ȋ I M̋H E̋DMԉUȉ $b$Uȉ$U4D$,$-$8UȉEԉB U$-Mԉ$UȋJ @A$B P H EЋH uxtEr@ hI MЋH EЃ|OMԉUȉ $@U9B @EUWVSY,Ev9E}C t;tًAat'At뽐t&,[^_]É $뤉 $4또&UWVS=YYL}EhdMܐt&9E}k<.vX`$3& `fp249E|&E㋓L[^_]Ít&뾍1H Uԋ&\ ɉ;q 1p24&p24Uԉ4$Uԋp24 1tH ɉH@ FFUԉ4$Uԋ)4e dG,Uԉ$+UԋEG,E䋻4 q @ HtA A @ 1  H{vxp24:< UD$D$ $MD$D$D$ D$|$.2UԋMЉEtG G2 }j}G\;PA  Exp24:< UD$|$ $MNMЋUԉEA@g}E8;A  E0G^<$UԉM`MЋUF @WUԉMЉ4$!MЋUFCUԉMЉ4$MЋUԅv4d1vp24fn @+)cv9H 4H p24>+OH 0v <>0v | fp24 ~ ~ ;uFUԉ $o$gD$D$Ǎ,c$0|$D$F,$tF,Uԋ/&41G(;F(tUԉ$+UԋAT;FTtUԉ$*Uԋd4G(tttUԉ$N Uԋdp(v|1H ? IOAMt&p24 A R1H 4UԉL$4$Y `UF @p24D$Uԉ4$D$UFOUԉ4$xUԋp24;~ Eԉ$TME HM ]u}] UVS(JD T@1EMm؃tz݃|zw D$$ [^]ËD${$UWVSO;ҋtBWE $UMUU>MEԋt@UԉGUE>"Eu M1F u <[^_]ÐD$p4$t4$<[^_]Ít&U>U=$UEU t&U8])'ÖBUu}E䋓hTH; M|hx}ԋxu 4h29M hp 7}u}hTB;| B} <M ]}u]É'UH]"&>u}hT;|4U@> }ċ} }ĉ  }ԋ\Eԋ?<}ċM Mċ#Eċ]}u]Í&U(] "v=u}hTp;1u|hPUxU1h1:U h}U <]u}]Í&U1ɉ]w!<udB,t@ J,4u#D$L$$]u]Ðt&@ @ $D$p F$ F]u]Ðt&USE E<@D$E D$.$8[]Ív'USE <D$D$$[] USEX ;D$D$$[]Í&'USE Å;D$ D$$|[]Í&'USEE;D$D$$=[] U8];u}hTp;1u|hPUԋUx1h1:Uh}ԋ &]u}]ÍvU(] v:u}hTH; M|hx}xM2 h29M hp 7}t+PXRU}1t'GtM3@E}9t@xFd,[^_]Í&t3x9uft;1҃xpvtsEEExtk &Uta@ 1Ҁ80EtQG 80"U܉M<$J MUt&M$- Mf11'USk+|PHx$Rv0yꍶ[]Ðt&A<t0<t<tD$\a$v[]Ðt&[]Ðt&UWVS\*,d0AEƒt&EtEt"EAx/ PR)$E`E|B;BBB@B+ ʋ(P$P +P P(PUPRP1,[^_]Ít&uStv A,[^_]fUMUBM.&H븐t@ 80륍$뒍vUWVS| (,d8@EtEtEtME$EE|B;BBB@B+(P$P +P P(PUP+PPR @(@,P @$8,[^_]ÍvUMUBM? US Ë'!Dƒ[]Ð&UVS Z'dBtluWJ tEHtt5IvZB[^]u;t^ uӋ[^]f 닐@Аtϋ@ 80뽍$(먉'US {&;~[]ÍUVS :&|JIBJ$H (P  H HHp H @t$(0F[^]Í&U(]) Ö%uƉ}D$B$Fplj$D$4$|dD$$]u}]ÍvUWVS %)ƒ~u|Jzx#Iv-0yꐍt&PHd[^_]Wt7uҍPxЍ&D$D$$r&P랐t&U8]6$}ud)ȃ~_QA1tBt(Hvi]u}]Ít&t3Pލ&L$ $UD$)Uft3 랍&t$B 80녍$rv1h'UWVS)#lEU܋2zF t F @ NJMG F <G<u]E䋓xMQdl[^_]Ð/@ 9u}vE䋓f4$UEUȅt F x0<$U&1ɋUȅFEt5F Eԋ@E%   QOvKMEh$92@ z50QP';RPxd2f4$UUȉƋ@<%F @v<$UUȉvG @D$ D$At$<$UqUȅJBdl[^_]ÍG xFEvPtNR?@ 80+t&vEȉ4$EEOt&u+mt&pVv4$F+t$D$Uȉ<$Uȍ42$y$D$|D$T$@ $MD$ $Mȋ@ @$'UWVSY\UE܋d:tGf%f=DHU؋u؋ ;+4$$ fH<`|AI@T(M H8UҋtMAUP4$UŰdB0D$$$$R;t$Em$E̋Rd$UL$ Ủ$D$K$$ $D$d$B twB $VD$D$$D$D$ D$D$,cD$@ @$U%Ủ$4tGf%f=Dt pE@ B BBbP |D$$UỦ d@EME܃`$UŰtt 2ftD$$U腯Ű @ d9Ƃ \[^_]Ðd:t$ EԋEM܅@E1E趾pB 8@ x }Du>?u+B FaD$T$$U܋MԋPH1\[^_]ÍvHu؃_D$"D$$MM̉Qv|D$$D$UcŰBu>%_DBoM؀ ^t&$M赢M#t&$PŰBGf%f=DdD$D$ $UUU̅EE܋ M;6M+E+E܃E܋dEIE܉HED$M؉ $UnU| P4RpP$F(V V(VFU؃F ~FEt$NFEf}9$M荿Mt&M M̋>D$M $D$|D$B $4X&D$$MM̋@ f$UuUt&D$$UUEt&D$$p@ $UeU;D$M܉L$ $UӾỦEU Ű MMЋQ pA @D$D$ $t$L$T$$zra?DY4$D$D$q4$#t tu΋D$aD$D$ D$D$4$VE'$udF$E$bt@FF$ܱF蠥dMP 4ɉt6P BtP҉P P EBD$+F($=P(tF,V(t$yD$D$@,$@,F,t@ Eȉ$觿|EB;BBUăUB@B*M+ ʋ(PP +dP P(PUPHR @ fPP 1ҋtQl`@P$@(dP,P;Vҋ@lEt R RUp @9ƉEEGt&Mčx)D$ $t$&EċUMD$T$ $轷9}vbt^E$}D$ 4$)|$EuEĉ|$t$$迷UċMET$L$$VUME1҉ $D$EdU;`vMe3 }|[^_]Í U $M4UMT$L$$޳&dU;db$py踹ƋHM@@ H ET$L$ 4$D$aD$սV U@EafD$$躩t&4$ufUMUBM-&M$5Mrt&EMD$D$D$$D$ DL$$t&MEL$$UT$D$$$˝$MMP ` Ft&t ~@,F, v1N'Ol$%'U8]6u}0)t$4$D$蓵ƋdV@U$舚$谢FU]u}]É'Ux]9æuƍED$t$$y 1]u]ËE%=@t=`tލD$4$p̍U]3u}EvtltEP]u}]ÍvBU$芻Up NjET$4$D$UEcDD$t$$x0Wt2҉WuE<$赳Eut&E͍E<$EfKt&'UWVS9d0@Et EtEt葳EMA01 M@EA EЋMЅ U MЀ9 08 &dUU@f%f=D UЃMủΉEԍWE_@9D$ D$UЉT$Mԉ $Y|$D$4$¡D$D$Eԉ$ F t4$+v$ʀD$MЍa$L$!$艌@ =@ t&D$,b$փD$ $p@ @t&UE4UVEU&fuD$ D$D$Uԉ$PMA A cv}MЍ$e$L$+D$ $Ʃ@ @!F @EzPUċP t9Ut$MsUM@U@ CMԀ9.MԉM1EEEE7D$"D$Eԉ$cvMЉ $2{D$UB $BEЉ$E~kD$D$UЉ$i@ oD$D$MЉ $B@EЁ}W&Uй EȋEȉD$Uča$T$譶D$$E蚪$0U$$M̉ $E |$ UT$D$d$0vD$ $ȧ@ @;D$ $譧@ @EԃMx/8ȃ8/tE,D$ $m@ HD$"D$$蚸UйdED$D$EЉ$ӝD$$EUW1VS芹lutU@ <HMЋP8UċHHuMȋWEEJ@EW t-9Ɖ[D$|$M $t+uuDt&$D$D$ U1Ut H)D$|$E $(G_WEEt<$ӶEEvU B<ftu 4$IF U <M1MȅEB<t0HMB EЋEf9Mmt&"E;U t(JMLfEPE C`El[^_]ÍS‹@<.$1D$UAMиUT$D$E$UaMȋUE}UE虮`A $z $hU+EЃI`A  M;M+ȋMEЉUE0MЉAD$$xMċUtEЋMЃEԋEĉAEԋD$Mȉ $U͕EԋUԋҋU~9EЋ@<EEtE7uЋp;aU艓UB<qJ AeJ fAD$T$U $E辚EBUąt%MċQ4҉QnB8}t%MȋQ!҉Q+BH*$EzE&O AkR fB- U CL$D$ EЉ$UM軨UM}EE9EiEE+ED$M<$L$EU譔UEB tO M)HM1DED$D$<$q‹E&L$T$D$ u 4$UM*UM<$ʉT$vsl[^_]Ít&EEE!fD$MЉL$ $AUEUHUE$D$D$U趱MUEEЋ@ @vUĉ$EvEUȉ$EuE $EEEt& $E-E~t&D$EЉ$UM跦MUfUp U M"Eh&UWVSÉE UMuEeE1UME葩4$D$D$詞4$[{d$9>t  UD$VbD$D$ T$Uĉ$UD$D$ pUEUG$賬E$腒t@GG$MEGL$$6UT$D$$$ z|d $19>EEdE|EEf%f GfEB;BB| B@B*9>DшM+ ʋ PP(+P (Pd@PHR @ ʋfPP 1҅tQlP$`@(@P,E8UD$$r|JIBJ(PP  P(PPHP @t$6~Uf`P蹞\1ҋt@M軌9> Ue3/Č[^_]ËU@$D$E$|&Pv3PU@@ @ EET$ U $MD$ET$D$A 80t6B<f$UЉMtUЋM̅t& $UtF(UЉV,BN(A% =tUD$D$ $UЋB<GBBu$րv$UЉMaM̋U& $UЉM`UЋM̋BED$$(+vUD$ $ Unt&`D$D$P $|@ 2fA f@t&B f@v$UЉMUЋM݃iB $UЉM貘UЋMكH[w&A f@}t&t{fE}fEffnv$t&;$UD$"D$UЋBB @B f@T뀉$b`A f@vB f@)ZUWVSܜIbD$D$ $?W G u\G 1A$UzD$ D$Uȉ$T$ElEȉ$`W G tx뢋Fff=GF$e$8`WGxGzB_xR?8D$$TcD$D$D$ D$D$ D$D$$ƈtL$He{uhD$ $貌UF$WGG28D$ $而#N$M؉ϋ G y)E܋EA}܉ENjE}̋9x } |$M $Ul}؋UȋAEЋEЋ}E|8}m؃tz}݃|zwgI}̋@ |$L$$Ul8E؋EAGUU{\}؋Uȋ M3D${$+vU]َFuuH8tKpB tzD$t$$tt]u]Í&tD$t$$s뺍 Ht$$S렍t&D$${@ n&U(]}lju0lt$L4$D]u}]É'UWVS輍),|B;E~|4@rσMOwJhᐍt&F$$MiF$P҉P|BB|B;E,[^_]ÃBF(F,SP,҉P:$n-FHF Fk$[|BevE `P Bt$P҉P`P F BF$@ @zP҉P$ cF$$|$4iF$`F$HF,V$@ Ft~V(҉QurPtP҉P$em|Bwt&UF(t&P4$N5$m|B"$N|B @ +BB F$RP F$@)F(tP҉PF,tPtb҉P>*$Mv$MHv$Hl`P 8$0l\v$M뢍$Msv$M,$kV$k>vUWVS,Ù<|8wx4vG}у0y؋dxze$qP|8vWЃ dxe$"P|8G9~kv4$_|8GSvyS׃ E<3}Ԑ넍Ћ}ԃ aG94@w F(F  F(9~:'V$ƒ t'F<[^_]Ít&$VčvtыF <[^_]ÍefUWVS<é|8WRGt#0y퍃f$N|8Wf9||4RwV(V  V(9ы~8~$U$VF[^_]f4$]|8WlFUWVS<éldPffP@tUP0@ u.9u#i$\Mf2@98*|DžP҉d RbDžƅƅpt&:t1UT$$80P: whBPt vf$LF$K'ƅBxBxƅOJtx ƅ&x  H$ x( G p9΀ui$K&Džu51l[^_]Ít&:vbƅƅvb$L$hJDžtegt&t'@f%f=u鋅$Iuft7t-o@f%f=]O;H}~1I$ YB@BP(P  PH(h;4 PfftZgt&Pt4Pffu⋍ $HPuҍmvHgD$$jt&x$vavPD$ JT$L$$#~t@ peD$ D$T$lj$\@f|$$Gb$GtG;|pPx/ v v10y拵g$-Gp9?4vpFЋ( F F(FЉу ƒ/(B=DžDžƅDžrTh;$ID$<$h@=RvtF~<1ɉΉ׋$9N9苽JIBJ$H (P ʋ H (@ ;+<$P$?\$bLtD$"D$$|1ƅ8@0 ~@F(@@dD$ $g\D$!$Ef@B P  =`ҋ@ @F `@ tBPV$F,H 9|3Hr 9)p J p 9\Dž߭؃tz݃|zJ  $t$D$Y AtB @%Bt$1Ttb9uꋳtAp `@ P@HH+9Dž߭؃tz݃|zR T$L$$XƅpFV(҉P{FpP?҉PW$\Jt&$IZV$@+9Dž߭؃tz݃|zJ L$$L$W`H At$HFɉHr`H F A B +AA HJ @B @BBu$;[$ q‹$D$VB% BV$ƅ/*f$?1 $COpL'f$?G9VHV |$$_bD$D$$cu ;+4$D$BW.'L$D$$YJL$D$$Y&$:`H `f$6>$Y`H up Dž߭؃tz݃|z $D$raHJ 7t n$rt<$k@$9$9s HD${$l'UWVS\vɑ,dx"@"@|EE8W9G vLqNffM؉uȉUԉ!t&$Q9}r;}uڋ@ u҃E$2ẼL[^_]Ðt&E܋M؋Uԋuȃ+ELM&@D$%c$5|EvF(tPV҉PF,tP&҉Prt&F(kP҉PR$҉PP F BF$@ @hzP҉P$ bF$$|$FF$`F$HF,V$@ FV(҉Q(u؉2P҉P$Jt&EEl[^_]ÍHEFFfEV F1҅t$M8VMFEOJt#UMXEUMff=DEF$$MjDF$MtP҉PVEEUZt&$x+v}̃9}UuĉΉM'&@ u$@JE9}r}u׋ۍvEԋMȋuă+ELt&|D$D$4$VHF0%_DF@ +BB F$RP F$@4$*vUԍq$MeIMA1"EX$E*>E9EfEEt&U$*v$M)MfL$<PE4$P_F$MGMt&$GP ;QMԋ@ t$UHHUG;oQ<$UMHMAGU\Ge<$UVGURPED$$R|D$T$@ $E$FfqEt&?EGA@EȋB E܋E@ @ED$D$D$ DEȉD$E܉D$Eĉ$MUPUd$T$Q+MEU7UM7Mf<$U'UEEx-iD$ E$UMQMU@ @E%E@ 80%vE$UM\UM&UWVSc)lH}pB 00F EJy9xr@UB XMz F '@EV +E:MEHJ9H OiD$D$ D$4$1ED$4$D$RHM@+BF $ D${D$5%t&|Hx'p9EdEuȉ}1EEFEE@tU J'* &f19EʉF@u^E}t +MȃtJz*#_.F0>ff>tEE.E)}҃WMȍWt UȉWW  J}t BJ1}E  9ẺEv}ă+M?Gƒ)֍UȍT0UȉU9W PUċz 1ɉUЉMm؃tz݃|z.Mȍ40L$}4$|$R)<$ CD$D$ D$fD$Eĉ$?JUāJ}K|1[^_]Ð^+~8~v E9E+Mȍw)t}t J9E+ J}t$1҃}t+U҉9Ev<QMEEEE1Y ?9t&1E&fJrqt&UEEt&x#PEE.nx.dx.ZER&x}r B}<BJ1B EEat& ERt&x#cU#Uu #t.4)G UȍO WU1EEUt&}PU}@EED$ $}ĉƋGEt%$R ҃QUtxCuEĐ;t/ļ[^_]Ít&M%A}āOuыB% =ED$D$$&}E@ t$R UMMʋ9Q  P E@  @EI MuE}IEEE)ȍDEEEEEEEfEԋ0Eԃw(it&EE@  @EEy }̋}EG t$@ EEEtM̋}}E܉M9}̉ME t&9 u9, E֍}Mu2L$}Љ<$UUG @<$-U< t< t< t< t&t< tf믍}u }ủttt1t&zu ttuErfE+Ed)MȅP1 9u6M+M$)Mȅ1& 9uuF  HM~ }̋uЉMF t$@ , 9M M9M̉MsK}̾ U}U   E9wUUEW&}G  HMG E̋uЉMF t$@  9M}}ȉ}M̋ẺMu19s2}f t9vt9wM+M̉M^}ԋE7u9E} EM uȉMfuԋ6uEw&Mԋ1}M }G t$@  8}1v  9uEEUE+P Q}tH UPExPHdļ[^_]Ð}ԍc7}ԍcEMЋA<}ȅEM1 9uU-t&uu}E9 M+Mt)Mȅ~1t& 9uJMuUEy 9Hp t t t t fzf̍t& t t t t vMf9rESvMԋ}M3+P Q}Jt H MJEd@t&Eԍc0EԍcE@MЋAMЋE1)ȉ%) 1كi9u؅ كD[1كi&9ugs9 $;d@ Uݝx-UE݅x\$t$uȉ|$D$ D$t$H )H $L$UG3U7N 6)N t9 }UERfMv9s z BtE *fx}`vE}.G.G.f 9Mo}t$$|$U+U8uй+N E M܀}}+P QEM܋0V|}9~ p L$E։4$D$}E܍ A}}G WEED$E$U['UEEE+P QD$D$$0EE9t&؋uȅ M1#9upivEEEW4E$&ED$"D$EЉ$U :MUMEf}f1 ut&u Dψ ;EuyEu4$UO2UESv}EG ׋+x yEt$UT$M $9}gD$D$<$7.D$|$$R Pu8vmUt&Eȋ}̋ủUElj}t9twpt< t]< tY< tU< vt< uz< tJ< tE< tAMDуUD$$'t9tv< u}E< tn< tt&돍U+Ẻ}EEEЉ$U3UfED$"D$Eĉ$U7UEE#t&T$$(}fED$"D$MЉ $U7MUEt&ED$"D$EЉ$US7MUE(t&}ZE܉D$}̉<$UUE+P QuEu7t&|$$'M܋R2&cD$$UUuȋucvI A׋+x yMt$M̉L$u4$U?U}gD$D$<$U7+D$|$$U@ A95u @ A9rt&E&Ut&K$UUU+M̉MEEI׋+x yED$D$$e*R PE4$UMU9ȉE9EMM̋ẺMu193} 9f t4$U8MU9ȉE9EaE9ẺEsE}̾ lU}U  E9wUUE׋+x yED$D$$1)R P ED$MЉ $UUEEKكD[hM+M̉MED$uЉ4$UcUEgD$t$Ẻ$U}1UE6D$t$E$[1EUU+M̉MEEȉEE܍ED$D$MЉ $U71}̋U}܋ủ}Ut&9twpt< t]< tY< tU< t< uw< tM< tI< tEMDуUD$$st9tvt&< u}E< tn< tt&댉U+Ẻ}E}ȍE܉}}D$D$4$C0M܋U11l$)t&UWVSL3ùNldEԋHM@@Mԋuԋ ủMAt`q N}D$ D$CD$<$!%@tI A< M(ȃ8ɍ|t,M@EQ }Ћ}Kw H\ΉutH;MpUԋEЋx BB8?}ԋ}GdxsEH t$@ UԋMT$ $uЉFuF9t& ?1 }űP D$EM|D$ $űUf9uT>G t G @ B vB @ $UD$ D$?|$&#Uą$D$D$U9utUB@}+}ȋ׉}Mq NȃUJ At&G tG @ 8t&$UD$|$UUD$ D$CL$<$3"UąHTt&u}Gf%ft$$MЋQƅtBBS}Љw0:t:tmH$}ЋGP\@)Ѓt=E@!td`Pd}̋>l[^_]Ít&(uf`$UЋB둍&EЋ@@uNE@H @ u5$v@ Ht&M̋ƐUĉ$UUĈtvU@ER D$D$$*EOv$v$@uFf\`A 8tCA$tED$ED$$e,‹EtUBUD$ $Uċ@ 9ɉ$Mԉ $9uED$"D$4$+EԋUD$$MЉA`MЋ$I ?MԋH,tID$D$D$ D$D$ $t@ t p1th$"&'UWVS|,G||EPxGW}du]]Ít&U]9 æ;u}>1xGW}du]]Ít&UWVS,R;tl|D$D$$^ǍWE D$ D$E<$D$1<$D$uʃ,[^_]Ë$,[^lj_]Í&'UWVS<é:,d0@dU}eNj)d@5teD$$$FD$G$$FWUUF U$T$G `d0,[^_]Ít&@ @$ Nj)%t$4$D$ t&VFt!}d$L$UUd,[^_]ÍB% =t'D$$$<`t&B vO$L$UvUvD$$ht&'U]f8u}>xGW}du]]Ít&U]8u}>xGW}du]]Ít&UWVS\71)|$<$D$NjxGW}du]] U(]63u}>q)|$<$D$NjxGW}du]] U(]Iö2u}>)|$<$D$NjxGW}du]] U(]62u}>A)|$<$D$NjxGW}du]] U(]Iö1}u7@ t.@$xd7]u}]D$$@ ōU(]F1}u7@ t.@$xd7]u}]D$$ ōU(]i0}u7@ t.@$1xd7]u}]D$$` ōU(]f0}u7@ t.@$axd7]u}]D$$ōUWVS/,d0@TU}UNj))d@'tlD$$)$1FGFWfUF U܃$҉T$D$G $$d0,[^_]Ðt&P FD$$Nj@ 7@ft ?D|$$Nj)t$4$D$FEFt}T$T$Ed,[^_]ÍqP tzD$$NjB% =uB t ?D|$$ &x @ D$$t&x 듍vWf҉T$$:t&D$$povUWVS-,d0@QUq}R‹) @tPD$$UL$TFU܋BFU܃ RUU܉$T$A2,[^_]Ðt&@  @$|‹) Et$4$D$UU܉Ƌ@)UU܃FU܉E%FU܅t}Qtj$T$dE,[^_]Ðt&B% =t'D$$$,pt&B vR$T$듍&D$$vUWVS*,d0@NU}ODž)d@et^D$$!$)FGFWUF U܃$T$ |$$d0,[^_]Ív~@ QP@  @T$w$Dž %)t$4$D$t&FEFt}Nt}$T$Ed,[^_]f B% =t'D$$/$T(t&B vW $T$뀍&D$$UUt&D$$h'UWVS i(U$F $$T$U$F$$T$U$jF$$T$ռEݝGF݅\$$Uĉ$$F$$T$菼Uȉ$F $$T$lM̍V$$ F$ $L$@$`t&$5$t&\$ 9@ u뺐t&2D$ $@ @I)VNt"E؉$E܉$d|[^_]Í&׍)D$7D$E؉$cSƃvԋE؉$t6$薬qU fE܉$]jD$$wt&$vt$4$D$dt&$v$T$\$L$FU䋃 щց1DN~ ҹx1ɋ ȉ&E؉$]t&E؉$9D$D$E܉$d@@uK+vl|$E܉D$ D$$T$$|$U܃T$ D$T$A$뿋u܋$@ t@ |$t$$ԧD$D$$JUWVSLdE̋P ỦEȋẼEċ@ @xŰB@ @EԍEEЋDuBfEЋUԉ|$D$$u;膣8 tܳfUЋEԉ|$T$$ƅE䋓ǁ1҃DэO~a yV ʉEȉt$$ŤUB @t$UȋẺPUĉdL[^_]Í1릍t&D$$`ED$$H_t&'UWVS)<}䋃dEԋP EЋDuJfD$|$$8uC8 1tA뿍&D$|$$ƅE䋓ǁ1҃DэO yx ʉEЉt$$UB @u^+EԃMD$L$ $EԋMЋUԋEԉJd<[^_]Ív1넍t&$똍]vU8]Æu}d0P <)~Y$e萺tcT$<$G @uAF~d]u}]Ít&t$4$D$t돉<$뵍1UD$ D$D$$Ug@ `UMáMD$A $_MA HU%d00U8]&u}87t ~ D$4$@ Ptt@$tkU$Ux1@$x8du]}]Ð@$貞u 뼍F @ E@$D$oD$k벐F 7PF't&U(]u}87t ~ D$4$@ @t<@$t3$kx8du]}]Ít&F @ E@$D$LoD$蓟莝u fF W@fGt&UWVS),7V@ @EUvt ~ D$4$@ @tD@$t;U$T$|E䋓xMQd,[^_]ÍF @ E@$D$|oD$胞~0u E䋓딍t&UD$$ U܉EfF '@6ft&'UWVS|,d8P E7t ~ D$4$@ @tY@$tP$xD$E$iUB @u E䋓:d,[^_]Ð$֍F @ E@$D$oD$3.u d8,[^_]ËF "@1ft&'UWVS<é}t$Id0<[^_]Í&<$UvjUЉD$$Uy&UT$D$"$)‹E2& UfEv Q/tUԉD$$芮E&UWVSÉ}t$2d<[^_]Í<$pUÍvjỦD$$oUs&UT$D$"$‹E,&D$$E UfEv Q/tUЉD$$E UWVSl<eE12dP <@ @ L$D$$=‹)~^xJT$L$<$rG @F~dUe3uy<[^_]ÐFVft$4$D$nuvD$"D$$v<$pcvKMt&'UWVS y,d0H $$vD$4$ōF @#4$蓴A$f裲$+볐 $먍U UUԃ}Jt&d@D$$%D$SqD$ $@ H3vU$ U܄9d@$%D$ED$t&D$D$$FD$"D$$1҉&,pU܉D$$UjD$D$D$ D$D$ D$D$ $D$4$F @u60Gw:VjE܉T$$ϝE54$蟲t&UWVSLùleE1d2@B R B PBD$D$ffTDˆ$dD$ D$BD$$tkd0Bff%fhB^G6H@d2Odt&@tDP+PYd1@ xK)`;8(H|8T$PD$$ t x $ *t7dBJft x 1ɉL$T$$菹蚇 FdVMe3 Sl[^_]Ív>G< t G x HPXfG G D$$訖D$@ $ۦ$詭$T$D$‹(҉}D$ D$D$<<$]L$D$<$蝚<$Dž\$1DžQf t+& t!t t tt t&F9~ƄyA t ‹ DAu@=)9‰~FVF҈Ћ9A׍D"&RQ@ 803=Hd>0&FHz pB uJdft$4$D$褥t&d1@ x@$襥@$谪$L$D$&(B%=@uAd@f%f=xFVdt&@$裛3@$莛~@$轖@$Džhp$t&@d9@f%f=8FV Ѓt&Rqt&P iRct&1@vD$"D$<$& Ɉy )5P:Yv$A%=@d@f%f=F&<$؝Ff@$D$@$豹t&$ *@ tr@ D$ $蓋 tD$$ D$諟tJ G 80D$"D$$Lt<$菸fj:> UWVS\Ld2@t>G t G A@t;>GxEԀ}2@tq@1t x tG< KtG x u 1ovD$D$<$ỦMMЋU@t&@G 80EvEEtD$D$$ỦMcD$ D$BD$$ŰMЅ0EFff%fwJFtDGt t6@Eԉ@Eǀ}ufEԉ82L[^_]f@ 7@,@$ỦMOŰMЉ$ỦM;ŰMЅF~L[^_]ÍvG f@E<$D$"D$ỦMMЋỦEԋE80< D$ D$Eԉ$ỦM艑ŰME10t&t;EEԀuxF~M<$ỦM躴MЋŪEyt0EEKKG 80E4<$ỦM^MЋŪEt&UH]9æ}ud@t@ uH@%=BJ]u}]Ð@ @ tEUElD$D$$=UD$ D$BD$$̬bEAff%fwGAtABt!t3@EԉStRHuސt&Eԉ*BJxBJt# 럅tB 80됉$U螲UЄx'UWVS|LdHE?Mā wM mM@t A @t- At`@Z@%- vaBJL[^_]Í& ȃtL[^_]Í&0mt&I A +EӈEED$D$$UδD$ D$BD$Ű$]U̅XEBff%fwuBtoAtMta@@Mԋ&@A 80PuvEԉBJL[^_]ÍH0 H,]xBJL[^_]Í@%=Őt&@%= 륐t&@%=`념t&H\;dt&@Kv@%=*f@%=@f f@%=Ff@/vH ;t&@v $U赮Ūyt-  A 80 $MdM̄ UWVS<é\dxE?w ;mM@t A F@t1 %A@$r{`dEH ME ETn@Pسq\$Mĉ $U蟘EċU@ @Măd E& ȃd\[^_]Ðt&I A E׈EED$D$$UD$ D$BD$UЋ$襥UЅd>Bff%fBA@sd>4U\[^_]Ðt&HxBJd\[^_]ÅA 80@m&d>t&BJd\[^_]É$`U h,f@@سqf@Hسqf $U轪UЄdt- A 80 $MfMЄUWVSLù\d7HMHE?MwM mM@t A AMЃt8AHh7H%E-wynnEMԉE̋Entj@ (@ eMԉ$L$U苗UȃeI7\[^_]Ív1EEEuUȈMv7UMąVɉL$D$Ẻ$UUȄFN녋I A ËEED$D$$UD$ D$BD$$谡Uȅ0EFff%fFA@MЋfMԉ$L$UVUȃx7\[^_]Ít&tj@tZA 80t&FNVpEԀ}[vEЉ%7\[^_]fD$D$$UȈMҬMċUtK ȃ17t&xFN $U赦UȄHt0EEA 80E $UȉMZMċUȄEUWVS<éLd0@P@f%f=`;tIXfH|D$PD$U؉$cU؅t z ( @tMt"!U艎U؃ t&)0L[^_]ÍJMāEJ M܋IMMM}ucH1ҋEffRA$U D$$L$耜(UE+B PD$${HXAf%fAf%f=P@ !@ D$$T$t(:$ 谦^P@ @ D$ $#v1sD$$ D$;1t&x!t&)9 x;UFU؉$T$ilPXU؍FU؉$T$FlQU赍F U؉$T$PU蒍FU؉$T$~QUoFU؉$T$~PULFU؉$T$~Q U)FU؉$T$kh,]F E\$$蔍Q@UF$U؉$T$QkPHUF(U؉$T$.kQPU蝌F,U؉$T$ kP4UzF0U؃4$T$}Q8UTU؉$T$}Mă =>v`;:ҍ|tJ I Dʋ IL$jEԉU؉L$$jEԋUfD$"D$$耦vMM @Uf%f=`ct&(U$ UU؄1vt$4$UD$IU؉&D$"D$$ХvP@ @ D$$T$i}(t&A$=$UBp#t&B @fvHftz t41ɉ$L$D$1&|`BB tŋ@v$zvT$t$4$U%U؉vD$"D$$谤vXf85p$D$"D$$pvUWVS謥}UPV @d78<[^_]ÐN UT$$L$:hy:d<[^_]Í$U9UЄuZd 뵐t&F PfvN UT$$L$蚝!mt&EԉT$4$D$e둍t&'UWVṢ9\d@M:r@ @EȋV@ n@ẼUԋvt ~ D$4$蟐@ P@$茊}t1}\Uԋd\[^_]Í&z G%_DGBW @@EED$G D$ EȉD$Ủ4$T$xMEBW @EMԉ9Z$U)UĄ^b MԋEԉQd\[^_]Í&D$$U=UĉE|fD$$ EKF nP^t&G@u`t&@EEET$D$ EȉD$Ủ4$T$"ExMԉ=PU܋G U묍&D$<$谐8$U $1pUĉS&EЉT$4$D$MD$<$&vED$"D$<$IUe'UWVS|,d0P @R 1ҋE;D$$‰T$nE1;D$‰T$$PEԋxU&% vA_% Naf$v@ tO$vfF >@EI+fA DxR4t&E$E$닍vUWVS̘9,0~@ @Evts~ D$4$@ PtQ@tH$UT$$7fxGWd,[^_]Ð1$UUupdMX GWM,[^_]ÐD$$EF $P3fvd@T$4$%D$MMjt&Gv'UWVSLù<HMԋpt ~ D$4$UpŰ@ xHB @ER UЋ08u@$+~t$uЉt$$XEԋxMԉQd<[^_]Ít&F Bx7H[t&$dUV uԋEԉNŰ<[^_]Í&jD$$:j t&ED$"D$$iEEԋ &d@|$4$%D$UU>t&UWVS\ɰ<HMԋpt ~ D$4$U耂Ű@ x@B @ER UЋ08u@$;|t$uЉt$$wEԋxMԉQd<[^_]Ít&F Bx7@[t&$,dUT uԋEԉNŰ<[^_]Í&jD$$Jh t&ED$"D$$yEEԋ &d@|$4$%D$UU>t&UWVSlٮL0V@ u@EFz@ =@EċBw@  @EȋVỦ}Ћ~Et# D$<$A@ @EԋE1t&MЀy D$EЉ$@ pMЅ…u u$ UMZUM dUȋUԅtMԋ@tD$<$TtptD$EЉ$TM̋ẺQMȃL[^_]Ðt&EԅYUԋHtD$<$ITPtD$MЉ $-T08ED$ ED$UĉT$Mȉ $\.Mԍ|$E$UUUBEԍT$E$UMUMA Mԋ@Ls|$E$M`UMAU>T$E$FUG @LsUԋP2@ x H 1ҋE;D$$‰T$6E1;D$‰T$$E̋x+&Eԅ}udEȅtUȋ@t$<$%D$蚂t&D$$PED$$U5UEfD$$UUEuf$mMԋP t $lUԋP Pt $lP t $lHuP uE$u&E̋M̉QdL[^_]Ít&A KpY;t&G @EfdU@%D$Eԉ<$D$M.Mat&kD$$bt&x E$u'UWVSLù<8W@ r@E؋G@ ~@E܋B@ @}E~1 8D$<$({@ pPtD$<$!P08E؉D$U܉T$M $9gD$<$UQUԉBD$<$UQUԉB @LsPt`@ tO;8D$<$D$E䋓xMQd<[^_]Ð$jP t $jHuP u<$Os&E䋓fD$$UŀUԍrE؋G@ JD$~$U虀UԉE܋B@ 9D$$s}E~1.$ dUtHtD$<$VNaL MEQM<[^_]fG pfv5D$$_t&dM@t$<$%D$}D UWVSÉ,dzp 4 A tc IM@tEJty tmEM$ 藆M܄7K 1~f뷍 $UD$~dU܉E낐t&A t@EtPt$U\U܉$qML$$|D$4$pLF @t4$BsGdw,[^_]fd@ $%D$ED$<| UWVS蜉 \d8H UЋOW7A  IMȃHUԋW1fz  $UĉMD$}vUċM@ x@F8% =@EEF E̋Uȸ?B;UɋŰ@08!@$oM̋UȉL$T$$zF tZ@È8t@dBf%f=mxЋD$p$N@EF @TEЉ|$$5JUB @EԋUЋMԃQt&@E̋0ɀ88M$D$[M@$nM̋UȉL$T$$`&U$ UĄt!d@|$$%D$qy|G EԋMԃQd\[^_]f $UD$EjdUĉEȋ9fMЍbmD$D$ $gE@ @urEԋMЋUԃJ념EMD$D$4$fUMUEft&B x t&4$@ov$0o넍$ ovBUĉMD$4$cuUĉE̋PM $LvMD$4$yM'UWVSl٠L0VUԋ@ }E fEm}mEdExEԋNEԋQ%=t*q FE%=EEă}0q :UȋM̉4$T$L$\xVEԋxMԉQL[^_]Ðt&$ vpȃPtx tmMк D‹Eԃ뗍D$"D$ $訂0:BkD$$1X't&@ tpt08pi4$&V4$jUȋM̉T$L$$k6vED$D$EԋF$T&EEă E}MfkD$$ZWJ'UH]قFu}0>Wʉȃ Mԉу߁qtsu+0d]u}]ÍvD$<$Ypt@tD$tdd1붍Mԃ wW ztWpvU<$$5QU;Bu럍vUWVS܁I,d0H @ tz t 0,[^_]Ít&B Et@Et@ u~UtUBt@t$MhD$M܉ $CMA @2,[^_]Í&FV,[^_]D$q$U؉MnU؋M܅E ;F+1 )ƒ~CUpBtv2xkD$$gL^,[^_]D$D$$,bf $`iME0}E܋`E$}$-Orz >R Umt&'UWVS),d1@tf>t tg)$D$<$MAM܄d1,[^_]Í&8땍G t@Et@ tD$q$MlM܅Ea ;+:)UB1GvmD$$e|\d,[^_]fxt&t$4$D$MA`M܉&t$4$D$M`M܉^&M {M!}<$M{$MM2v'UWVS})L0~@ @E̋VGB }ލpU޶ fUm}mދ8t  d@f%f=ỦT$ EЋUԉ<$D$T$h` bmD$ $pyN$M"LFMċdL[^_]f$EewE,t&D$$pEG 6H+A ! $D$qM]jMąE ;+:)8UȃB)VU_Fm\$$S`U)ЃT$$D$]‰Učr_UĉBM̉$L$=74skD$$biYdL[^_]Í&E̍ND$ EЋUԉ<$D$T$Mk$q.E̋Mqd@fE%D$|$$MZMEЉ$U2e$6Uvf{dHvD$$M[ME?fD$$Mm[Mt&E;EEE̋EEЋ@ EtEЋ@ @ ẺU؉E܍E؉D$E܉D$UЉ$MfcEEȋU؋M $M].k$,-M]EED$Eȉ$MQME $M]>k$,M.1EdBf%f=mt8D$I$.\$&I䍶UWVSe9eE1 01d)H  VN@f%f=t]f=tWugt&PdHUe3 Ĝ[^_]Ëtx @‹@<F~@ @%19vG@  p Dž$ `u d@|$%D$$SVD$$ X8|D$D$ $0DB @G /@(@$Lz$B% =F@z @ uDžA u Džd@f%f=8@ t@ Ha@ @11Džt&L19A +@ ~9dAf%f=t$L$A$a6=P +H H@ IH_DHA 9sst'19ƅvR1) 9sЋ)։+q ƅAF9 9++q 뭍vq Dx99q q t&D$ $pO&A$Gt$ $D$3)D$D$ $\.OA$GxL> t$$N D$$=$@ zB% )= D$ $UNjH DžB@3@Mu087D$$Z A @t $&GPD$D$ $>@ k9M@)Ѝ40 Dž9P #x @$DT$t$ |$L$T$$W5PQ @Q_ЀDA@@Mu082D$L$<$STkD$$Bs9dP HFD$${O9?40<$6D.k$! D AD$D$ D$tD$$aYD$4$L$?F2@z G G $QT$ $I4$ECXD$D$ D$tD$ $X>k$o Vd $=W$(V$,Uu6 D$|$$K%t&U(uu]XPt}tFtPt ҉Pt&7]u}]Í&$$(:Ѝ&'UWVSlXsL E؋ d4)M@@&z $U AUĀz $ USUĄ_ tGG\E܋PHdL[^_]ËMvB Q@EC@ 9D$q$U2EUąEE܍9;yV+UЋBCE؉yNYkD$$>4U܋dL[^_]f+E؃DE؍rE)Em؃tz݃|zD$t$$DE fB H@ EFV@T$E؉<$)t$MrRUԉ<$T$#*M@M,tGUGu<$7E܋xHPdL[^_]Í&$UĉMNUċME086u]D$$_)MUt&$U=Uĉd@D$$%D$2Gt&<$vMԉ $MR$#QzvMԉ $&&<$t&5<$`vD$U؉T$$M6M)ʋEt&$UĉMOUċMptD$L$$3F$UĉM|OUċMd@L$$%D$ED${$I&UWVS:Sçn,Ud@ttt 5ˆUJ<$|9UG;GG A@A +(H$ H +H H( PpHUP UP҉P$tB\D$!$:@0@ @P E$-@ ,[^_]fUMKGMU&'UWVSQ)mL|E܉UċJ4IMrF EԋP R҉UU A EQ0UЋUЉE؋;P U;q8AMCEP EЉU؅*uЉ}܋U؉σfPD$ $Zuމ}܋Q(~ŰT$$#%EA,A0U @(HMx8G p@< d$Uԉ L[^_]ÍvA4Q<Mԋ@D$`k$K$MD$D$Ɖ$ @ @E4$UUȉB4U@4&D$D$$NMP,P0|EċP4RUpUEăP$V(F  V(VF$$+F$tP`҉Pb,MB EEMB0+AB0gE؉D$$.#u2E܋M܃QpFL[^_]Ív@@H BU@ME܋xM܃Q뙐҉}bM+M؋pHẺD$$U"pUȉT$$ M@0)BEQ0UЋuЅ$Q(ffCv$v$8/v4$8I$M؉ $kD$$~t&@ HMP8EQ0Uf$HRU@D$T$Mԉ $e?&| MċA4@EqQkk$b+t&0D$ D$|$$E4(E@ t@ t8u-k$D$"D$$JʉD$q$$G]d@%D$ED$Uԉ$p>1gk$D$ D$D$UrUȅM1$D$$F4U@4Uԋ@$MDMȉAE E<$,LMUPt d FV<[^_]Ë08)it$4$D$*ES$ LD{d@%D$E<$D$:RvG @E @ D$q$6d@Et&EtEtM)M؉E ;+:)A2?Mk$L$.D%}7td1<[^_]Ít&;EtD$D$E܉$ 'UB @t$)0밍t$4$D$M(M؉D&WD$D$E܉$2'G M܋@Q @$U&U؈G @@$/~E܋@ EvCE܍JM9H T$ML$G @@$M܋B}܋G GxL>f}܋G@uSU܍FdVvMBME$EC$ E܉$.렉L$M܉ $U4E܋U؋@ E!UWVS9ZL7EVlU؋N D$D$ $M*;D$E܉$=:$UD$EԉD$9U̅E?5 ;_+)E܍VFM؉NE@ ip/rU!ỦBD$B$UFVMD$A @$Z7$+ut ;V+E܉U؉V!F$D$lMF N UD$B @$7$|+t2?(YlD$$td<[^_]fB H@EuE011tG @Ew D$4$Mt$ D$M̉Nj@LD$Uԉ$MM̅ZB t9;Bt4t$ |$RL$T$uP+fxPft$4$D$UaUȉ&t$4$D$<t&t$4$D$UUȉ:&ED$"D$<$M-M̉ƋEd@L$$%D$?!fEԉ$Uj,$UfM+M̋&'UWVSl.I,d0H @<@ @$0:umD$<$iG @uK)t$4$D$ƋF~d,[^_]Í<$뫍alET$$Er&D$$!@v$ ¸,$UU UWVS-ÉH\ 801)"7Fd1EEԋpB 8zzB ))9tD$t$$y $ EЅtMu_lD$D$$(=t&o1ɋ@E䋃dV EԉUЋUЅ9E. Ht$$Mԋ:\[^_]Í&dEԋP |$ t$$UD$jUB @EJ MЍ~ZBuH<PQ֋@EB Et&F f ItqlD$$UD$ D$UBf$UMD$ MUED$"D$4$I)d1ɉUԉEE$UD$"D$)UEv$UUglD$D$B @$p%UE$I|A o@ UD$$ $E$I $"$UEċ)  E;+MWEGMă Mȉ8D$*A @U$ L$UD$$ &J AE$UD$"D$~'U։EdMD$$ M@ |$<$D$ U1U% UE'UWVSL(ùC<0 :9)9d>UG @EG tUuqpt:B 8G<4ED$"D$<$L&tMu lD$D$$$Ǎ H|$$xUԉ0<[^_]ÍED$"D$<$%7t&dUԋP t$ w|$$EЉT$EЉt&1Ru EG &flD$ D$ D$<$>G @t&D$<$hG)~1dEHfD$$@ gD$t$4$fUS&{AdP[]UWVS%IAM܋x }f})ȉEE)9ɍp}8%MA% =tD$D$ $UcUċuEAN @F@N4$UUt&U1$[uD$4$$D$4$zu@vM $fEv$`EȋHvM̿u:t&EED$E܉D$MЉ $3} E1҉EE܉$D$"D$UrUĉEzE܉D$UЉ$%1ҿE`&UWVS<} v#GЃ  tDt&uxD${$nD$<$HGuȋt JMW Uԅɉt*u%% =e@EG Eԍ& $@ UԅUUԍr9us&ByUWVS\}Sp$DF% =9ED$D$4$ E̋F -%_DFG PUȋHɉMx GEԺǃEЉUԉEԋUЍDHIȋEM9Mv;Mċ9J 8V ŰUD$)ẺT$$MH}MЃ}ԉ#E" ˆF @t4$\[^_]Ë@EF E̋F D$4$LFt&EEԉE&t{ sEȋM̋UEDEDEȈDCD$<$pEȋJL$4$T‹EfEȋM̋UԈEȋM̋UEȈDr$|r$UWVS<}Fóu@ RU@ EV߉VA t$ A tYUT$U |$D$ T$UD$4$T$nF @|}t 08u<[^_]Ív V뜐t&4$D$D$ D$tD$0<[^_]ÍUD$"T$$%t&4$wvUWVSMA@u }IM}%DGy%!X$OҐt&@}I2rMq D$D$D$ D$D$ D$D$4$EEt@ [@EEUBыRU܋y }  }}E}čdD$D$D$ D$D$ D$D$4$ Et@ @EubUEE܉UԉщEЋ}119}1u}ΉEnt&Z;EU;uvAME܅6UԋMЉ$)эL A D$UMiUM)ƉEԉM;}VD$|$U$9EvMȃE4$D$D$fv% = PxD${$(I2rMD$D$D$ D$D$ D$D$A $uEEt@ ?@EăEЋUBBыRUy EEuF9׉U?xGU9J8yE<$D$UEljE19׉UsF1UȍD$|$Eԉ$A;Et9EvU;}rˀ}#M $nMA  PUy HɉMK MԋMA @;}M1}uĉM4t&MpE;u; HƉMȃ9UEȉu }M wyuEuƃEv}G  PU HɉMnuF H91Ĝ[^_]ÐED$"D$}<$U{EUMA C HEM܋x puuUԋV 1;}s#UԋMAx9w}W@QE$|A&@E2ruIMq D$D$D$ D$D$ D$D$4$2EEt@ l@EEUB'ыRU܋I M |EEEEčdD$D$D$ D$D$ D$D$4$EEt@ K@EEM UEE܉UԉEЉUȃ8}1M9uuȉEEE,";UE;}ED$|$U$v9uЉsLM܉MȋMEԋMЉE)EȍD EЃ D$M̉ $UU+ủEEЉE9UbEM4$D$T$VY&Mȉ|$4$T$UkU&UȃED$M4$L$]fu+EԋU€}  MB}G@t <$GU BĜ[^_]ÐED$D$E$UkMUAt&Hȃ Eȃ@Eȉ}ʃUt U E;} U1EM܉uuԉMȍBUEUZUE}9U D$MDAD$Eĉ$EċE܍v9$,<iD$ Eȉ<$D$)D$=mUB.D$D$Mĉ $'EEċE닍v@ 9׉E1E܉ủ։E&MfE1Ep脥ED$D$M $|,|->;E1};D$D‰D$E$詰};MA HEM@ E9O΍:L$$ED$|xx|9$`Ĭ[^_]Ðt&Ĭ[^_]fD$$ED$$D$$Ĭ[^_]ÍED$"D$M $|M䋕|E &EH t'D$D$M $|\|EN9H  MA <:t$|$$|fMpu@N |F @08D$D$ D$tD$E$||Lt&) t$D$ $E|"f|D$D$M $|E|Ht&4$(|>t&L$M $|c|@ @s&'UWVSEICu:teG G@EEU>UvCB:Č[^_]Ít&BETwM^G% =tD$D$<$UDUM9H 0O EMKD$$D$$UCUEE@ @EBEX,G D$<$UxUBt yED$ D$D$E$U葱U1 EEE*&G .@EO M9EUD$8T$ D$\t$MT$L$E$貯ƅUUPW @G @<$WČ[^_]fMT$L$ ED$U$蛰뗍&MT$L$E$ZsvD$$UUEfL$<$U1UEE &ED$D$<$UUEEE@+UWVS Nt6D$: $>D)Ƅu1[^_]Í&FVfFNu ~& \|$$D$vsD$D$D$T$ $袡|$$BE$U J$Tl1[^_]ËB< [< S< K< C< vCf1vj tB u85 t&t% vt2 t t u<.B< < < < < v vZ~1^9M~2CF~< t< t< t < t< $FVtK< tC< t?< t:< t6< f*< t&t< t&t< t< t < t&uD$$ ~+@81]D${$UWVSU0;U 1+E TP߭P؃tz݃|z\D$譾u NjDL|H v@ G9rHt2@ u䉕DD$"D$$DHO볐t&+U LUUB r >/08 \|$$D$E>uXD$$蚪|$$z}EU$w:1[^_]Ðt&4$D$D|$$$fMD$"D$ $ƀ>/ \|$$D$.vkv \|$$D$D$$蛩|$${0t&8/t1qD${$JfUWVSi,d2@ )H`;F$UUXHf>2Gw Pt$$蒚t$$D$踠(,[^_]ËXf?y@o$UUU w$t&W RсL :$ GD$"D$<$( Xf8t(,[^_]Í&t$4$D$U1UƋH`;c맍&$ t4D$ 4$pt sD$$ D$茨,[^_]f@P R E‹@$D$ysD$N(PG 븍t&'UWVS\t&UT$D$"$UF -PXfH0|D$PD$$U蚦U̅ At6$ND$$T$Ķ(<[^_]Ít&A$to$!&щƃ ^@D$4$%D$uЉuԃ uЉփ}$ U Ūa@T$4$%D$腷A&UHuu]K}} tfF@EF Eԉ<$9t=F E14$ֻ<$]u}]Ít&F tNj$@ uEEE܍ED$E܉D$Eԉ$a}EԋE܋uԉE냐xD@<$D$`8D$虉nt&ED$"D$4$yE @<$D$$D$U*D$Eԉ<$D$}4$ݺ1 ED$Eԉ$ޓEԉƋEsD$$,*'U8M]uu }} wy t71҉UM$ ˾UMu\l 8fA t‹Pt@t$Ut$|$T$ $R]u}]Ëd@T$ $%D$끍v'U(uu]U @íM}t~ t31$ uY褂 1]u}]Í&F tƋxt@tuT$L$$t$ Z뷍vd@|$4$%D$널t&U(uu]}~ t-1$ GuG #t&F t̋xtNj@t$9]u}]Ëd@|$4$%D${떐U8uE u]}EDPHL|-tB@ tY9tU$1;E@ $۝t }Nj@$@@ ]u}]Ð$1E@$膝t }Nj붍t&1}t裀 뫍v$}tRtUǁ1҃DэO~ x1ɋ ʅ҉Nj?t&Nj+1t&'U8uu]U _}Ftu`1]u}]Ð%Hw߃ tft$ vt'd@D$4$%D$Zfc 1듐0th&F txtˆUD$<$耵UtBB(J,J0BL -t&'UWVSLù\Uu} 09Eu%E-v/1\[^_]É$Su'9wԋ@tvvt&멋8Et0: +} uE E 9ErU @ t^p MЀ9t08 \u814$ќE E 9E&U @ uD$"D$$Ȼ뉋8Et0: M 9U B@ @EȋEЀ8t0:d)ωu_t&tJ MIḾUB UЀ:t09Mȉ$L$C9u,Buȃ uрy 뿋:Ut09Y+E U Bуz;ZEEEE@ @EEG @EEEEȋUЀ:t08)ωuatJ MIḾtB UЀ:t09RMȉ$L$9uBuȃ uрy 뿋9Mt089u oM U A@ 8x HH@ .@EԋEЀ8t09Mԉ)ủ=@ t`@UЀ:t09Mԉ$L$ױ9u@u$蒎@ uD$$듋8Et0: +E NU } B@ @EȋGO@ @EċEЀ8t0:)ωudftJ MIḾTB UЀ:t09MċUȉ$L$T$|9uByȃ jрy 뻐 $ەNj@L<|t A|t* $躀9t$^9<$L$'|$D$$x H@D$D$$貑8 P6 $Дlj$FD$<$‹$z|$ $D$<$T$螟$蠓 $r$DDžxEMm‹;8D$D$<$+ P`MߋgBLuH@%= J *<-H|$$L$HA%=tRq@L<>]<<UDžD$T$<$o_@LsE<#t<E(-~| <-0:Er Eb}(}܋E(<$L$D$>@L|f< t< t< t< t< tt&f(vxL<HH PL1A i@zS&B‰ ƒ@t&PH v$z5t&FV< t< t< t< t< t‽ErEb<&Y<- M(x NjM($D$E܉L$D$D$D$ D$D$2։u Bƅt&B<$o $D$ߏEƅ DžDžDž'Et$u(t&p@< t< t< t < vt< uf܋U(<-0:U(u|| EwDžmEb}(}܋M(<$T$L$>st$|$$gUFF<>t<<E(t9|0ƅ+: DžEV\|D$$s~0:y>EwDž$Eb<&u @< t< t< t< t< t<-t&u(CϋE($D$E܉L$D$D$D$ D$D$ƅօuk<:PP<_ED$sL$$ t&$F9vJ|GuA9G8 t t t t 9w @L<< t< t< t< t< t怽ErtEt:-)|$D$4$蛟|$D$D$D$D$ ED$D$sD$$w;Eby)񉽘,:-&< t< t< t< t< tt& tT$$vBLaEa$P@e;;@L6@$蜈w;B @ D‹@$D$uD$!B @$ D$ $lc tD$$ D$踀$D$ D$<$/EtEtDžrz=M(ut f< t< t< t< t&t< tU(. QxE(1ƅE(D$D$D$E܉L$D$ |$D$4$e‰kv$ d` ~zCu@L-ƅ@ @:P 4(EtB @ D‹xb|$;-dDЃu|$ T$D$p~2yS}(t&D0:DtD$$r}܉|$ $lE([&녀t $rl0< }($H $0p $a9蘔99ȉ@ʀxLsu@LsE(D$D$L$ƅ‰}(@LD$u$Brt< t< t< t< t< t <:vf`@L-}(<ƅ$)׉|$1$D$ܘ1E(Brt< t< t< t< t< t <:vf @L-}(VXuD$-$sD$$ ^{rDž tT$$o)׉|$1$D$ߗ1E(W)D$ D$|$4$mt x v{[D$ D$4$ p1҉@L>sD$ mXtD$$ )z7Et}܉ $|$h@L|}(Z8Xf1҃踑:ZtD$$n3y}(0봋A kD$ $}Y<$Ouƅ`@ S@j[0uD$-$]t$O@L<R<$t&UVS͘:0$Ɂb4$D$r/tD$4$hE4$D$D$}uD$4$rD$ D$D$D$D$D$ @D$F D$$]E p v0[^]É'UWVS|uSF @E@}tMPMу MȋEȋF @HMЉU8$D$vD$&D$4$YF @$([F @$eD$lj$F D$|$$vF P@YiRU@ D$ D$D$D$D$MЋ T$D$4$ɉL$ 4\dEЋ0:}UԋBRM%=ŰIMMЋ:t:fB:f$@uE䋓D$<$D$=v(V@D$ D$D$D$D$D$ @D$G D$$U[Uz$XD$ D$vD$$}D$4$rWt&$|yf]UH8L$$D$^HA%=$D$vD$&t;$}F PUT$D$$U=tD$$rh}8-*dD$ D$D$$f$oF @@@$o@@ @@$zMȋUԉT$D$$qD$Uȋ$踏MԋE9AuU9QtMĉL$ẺD$Uȋ$_F @@|[^_]Í&$D$*U}^U|D$L$<$EusUEuf)T$t$D$ <$EIaD$ UT$<$T$&aED$*p4$]uu:G D$$aR$U|$ D$$D$4vD$zD$4$vT@t x :D$$*@ P@$GdMȃ$T$f<$TD$ $D$JtD$q/t&T$<$k&D$4$~@ =PM`BD$$];t&|1[^_]Í[Q$!TD$ D$`vP Rfv}vtUPMMЋ1w@D$$RMM@MR$ЀƉ$kFF4$mq15tD$ D$D$$Jb@PM*dD$ D$D$$ b$4k1.4$uR1UWVS,E&Óx t,[^_]Í@ tptߋxL>@tƉ$y[t@$gKOljU@$'oU@$,[u@dx[U;J$^:f@${bt@$g}D$@$@농$܉ftD$t$E$_D$@$'E,1[^_]UWVS謍Eh0VUV0U܋4J$1J >00417y80041090w }rM|mxB M9A8r5} ;BPv rrD9G8sۋE܃[^_]Ð&UWMVS)Ö|7t)9s% 9v 047u[^_]Í&r vt9vy9r名t&9vs€?vɐUWVSu虋x8ҍJt&9s" t&9vЃux1[^_]ÍJ vt89v4y9rt&9ƍvs€?vuˍv~[^_] USUXHt2H8tJTHƒEEƒ|[^_]Í&E t u t^EuLwD}t>uDEuЃsu EƸeE@6EuD$EUMD$ D$t$$dUME%ɉ}MuUD$L$4$WUE Ƹ}Eǁ MfEE@(Et(U`UɉMH_xt(Up`UɉMHu _Lt&t U@`UɉMDH  t U `UɉMDH t U_UɉMDH@tU_Ux}5E@)Et U_UɉMDHdt U\_UɉMDH<'tU_UɉMH tU^UɉMH@tU^Uf9MM}G i 1Mt&9u> ~9މ&9PvPvPЀ v <_t&9wt&( 95< *< "< < < t&4< -< v"< < <  9w9t&f< t< t< t< t < vf9vw} 9uf 1Mt&9u9*E܃9P.9t:9wv9[1f <ƃ9nPv< u׀~ uԍt&<vvvvMɍv 19u Pv/<<~FX<΃9u9}Em 19ub < t< uƃ9u|9}݉<<H<<`~V~fJt&뤍F tD$4$<=vD$4$<$6u+v9E> t&u4? t&b9t&wQ1}19uUwv9}E܉t$D$MЉ$_AMЅ9uwU@҉E91Ot&JD$4$U;UBtb9u9}D$4$N;=vD$4$7;$MuvvD$4$;<_넍U@҉E9> x1\t&JD$4$U:UDB =9u9} > D$4$h:=vD$4$Q:$i4tD}9u1U f9}> t#E܉t$D$MЉ$J?MЅw9uwX]}E19uUw3v9}E܉t$D$MЉ$>MЅ9uw }19uUwv9}E܉t$D$MЉ$O>MЅ|9uw9yu(ƒT|9q>tԋE؉MD$D$<$MЄuDh}9u1U܀> uf9}> t&E܉t$D$MЉ$R=MЅ9uw9< vu< mUB4H $UMD$D$z]UMB4|8G @t5@u=D$< $UM1UMB4|9x0aH4Y9oU‰H]Giôu}EEE܋B4<H t@tt1ِ]u}]Ív $U=D$$EUU؋MԄthB4|8 G @t.@t9oD$ $U؉M1U؋MԋB4<L8B4|8 ;x4dH0\t&tAtAt)B4M붋B4M뮉 $U`+U؋B4땉 $UIU؋MB4|UWVSgi|EЋhVP+MЉEUɉME}T 8; }M9MЉMM1ҋEċUM}}ȉM؋M<}̉Mf}U؋M~|M< hxM:}9U}~M<U| hxU؉9}M~()<M|hxM:}9UM܉L: hUUЃm9щMWE)ȋMč}VhPM9NP hHU:V hHU:V$hPM9Nh }PM7 hPhE|[^_]f$ XhFPEȉU@hU 0x$\&'UWVSD8De7F@EBf~$$M}VP+GGFDG FHG$FDFHGPFPGV89WwSRW(G?EEm؃tz݃|zc$D$IOUB(V8t.uN F;~!&@N 9|拻hMUI \U[$,H`DUR<iL? `hx@ @8Dž@=BA<@ SLp\D$,[$0b$Bp $Bp0409vAp02U jaE<1Mƅ'Dž(Dž,DžƅƅxDžlEDžEDž@DžPƅ;Dž Dž40t&U0BE9¸EEEB=vT@Urt x -NjYMzwt$ T$$L$'w$YXzFUBF$MQV(M9i+t&Ex U=EM U))ƋiNĉ9rٍ9wϋEpxHEtURE+uUxi;;uu։MUUME[ UB 9EtE$ELD$L$ ‹EM$D$H‹MA< t< hB$EPn[[$T$UT$F0MPIEtt2E 8.0U}MU}}^UMMUMAU MhIHMB@Q@ DP @EMA d։TEAt1;Ut<y4;E|׋dT^U MAQEE MH PMAHALA ;PAUD9PtIPʀ}/040E9Et6}/}0XddUE:tUM+P;QPh~@}/zZ}0GZPE0L$D$$]#0 fEUMt [P^ ER E@E9Et)Uz"OMEMU:UB+E9PPUHMy"HRPUtD$T$ $ \CREE[t }a:ExBA6UP EM0@U}EU}EU[,},X:YMy ;UD$$&=9R56MD$ $&B :&EM[t }8ExnB5UP EE[,},D:XMy:UD$$&=QG5MD$ $%B 9EU[t }b7ExNA4UP_EM[+}*:WMy-9UD$$%=8PY4MD$ $$B9ED$$$<_@8v\F;}BhDlFi,A0F MQTVEx649s2Ƥp1MF9%UEUPMAQuȋu} t&Ptd.uSP; wHN(~ +N ׋M~+NLN ;vN$M;Qt"Mt};W$=Pv$Tuu}E1M0}GFU`1~zt z4UBG}}}hP@E<}@1IFhU\DB hHB$F EB}\ 8hI\EF P @@Ux(}]&}~EUul`N49v|,0}p0O2E_NPEh@ \TM; M1| ʉIBU IL \U|MRU\E|,E\BR @U+UD$DI ɉM`B 8OU;t)@ $D@ Q DB x0z0D$g$C0UB,@ BDYt$$TMA4Ox(MQ0Q4F'-}G8UBFTB+BFXUM;JCUM;J/UM;JvM E;AtPE@< tt< 7Bv B,>EDžPEa2EA2E0 }_ Ш>UMBL$tD$E[D$ED$PD$ $D$ T$aD)M08N M9},: @ 9:D$D$ $3UEƅx҉1hA<6\;}$!4DGt\1;1,[^_]Ë\F;:F UlV l,U`F1A@A0UBN)F`hЋJ@UD,9EEVF;Fz5;MM}t&;Ft6};~8ELUD$ <$D$ T$2;Fuʼn}V;E70}E}HV҉UtX~ o8xx }DA}U+G}׋EU@ȋ~+BD}FW$}tUB$t ;F-}}F0EsV1~ ҉F tZ0;FEx4,N}OEVUEx<9}GUUVF u0뢋\F;i1~  F,V@9VMy w8Vڅ @A$E/EEMAV ,t$EH 9щMtUp;VMF,$(E~'MEEIx M8Vڅ>HE@ $~8MVt~ tEHD\F ;.F ;F$F My 9EP}tUB$t ;FVt#[BMI9t ;F[0~}t^~ :EU@z EAB}U+G}׋EU@ȋ~+BD}FW$F0EwUUFt~ tMQD\F ;@-EMAhV,|$$2BF F URV(9~#0}}FEtj~ 4UA}R UtG$iU}+BUUȋ}+BVD}FW$UtUB$t ;F)}}F0EuF \lF;-h^lA,;A("-= !li,V MATFEF l\0F;,h}Mylx,(lN y }AEiU`MU}x\EЈxF;+EP ;F v2}} WD ;F wM}Q Vp$B<8t<`$0}UMƅ}V lFj,B0V NEFF-V,MIMEH$90MoV5Uƅx10N MUM;JOM0P} ;$1$$$<0MUlJG O0躯F\FF @EcMMM$i$v $D$T$$]$pUJQV[?AEFU}BDgDžPED$$o$ED$$J$bZUD$$%$5ƅ;0F (;UB< <`MySvUB< < 0rPUtD$T$ $4FIV,BMD$ $E_ }V$EHy MyV$|ED$$$UD$$$ED$$$~EEE܉D$EUՉT$$EML$MΉL$$LD$D$ $D$ qFLD$D$ T$ $FFL$$UtJ@BT5EHI4$;ЃE@H79< MUBMu00Ex0MAEUE+BDttEMATM0NV -Eud齿R$|Myѥ0My WEL$D$$eEUMA9!t&UB9:EL$D$$uMAM:0F}OEVtF@BfV U\;~wEE?UƅU/Nt1:D$$a@ D$,$UB4a4dj$WEL$D$$UB9rE+$D$r1ɉEMm؃tz݃|z$}Dž4G(x(,MA;ED$T$$ujUB>UL$T$$E;HrUBYMxD$L$$gttMM‹A9sEL$D$$tUUB뽉MAEM‰ыE;H-UL$T$h$LU4_W$1l& v3W$5@vv W$-fvvW$e/vvƀ (*(ыEPu <_E:U\+EM409UUMMU D$$N=xED$P$#PBtX1;EjE~UE蛐kEME409Ue}'1?ED$$¸_u뇍GEUOMEE^u)։uU))}M9M(Eu9EsUd&UM$T$L$ZuU{E虏iE9EE;Ut9Uu}t"uUM$T$L$t빀}!E9E}0< MtEEE9EEw1}G#}9}VdUU DJtMdUE聎QU9UUw1=}R E9E}0< UtMEE9EEw1}}9}tUU DJ tEUE蟍oU9UUw1[OM7u$w4Uu0EE&} }9}UU DJ_tEUEU9UUw1}WE9E}>< C< ;< 3< +< t&tEBE`0E9EEw1}QE9E}H<t EvEE9EEw1}U9U}HJtEmE苋[U9UUw1G}E9E}Hv<H$tEfE E9EEw1?!G$}EuփuQ GDE@tuT Ex+F,pV0U $U$P1PƋPND4$EF #v u}!MIɉlg$p9uV}ЍE̍Uȉ\dX$,uU}EEE<ɃihF EEDžt`D;}X MfEEEt:UMR+L1҉uEM ;MrUuMDg E1uM}EEЋMQBfUMUA EU}|t&Lt^f}tA}ωD}W$9Dv'D)׍W};WsW9rt&Ur6Eu}}̉DUuD;}|u}E9E}<  <  < tEEɇE9EEw1}E9E}!< t < t<[ tEBE`0E9EEw1} }9}UU DJ e tMUEU9UUw1}DE9E}:< t< t< t< t&t<  ҍt&tEKEi9E9EEw1%} }9}EEE?<_tHEtMUEuE9EEgJtE׀}E9E}2P(PPЀ <_tE7EU%E9EEw1};}9}EEE?t&EtMUEۄuE9EESJu<_tEӀ} E9EUU#""EE9EUUA}SURUA}SEtMUEEE9EEk?!ƒT4E뜀} E9E}HvHvHЀ v<_tE0ENE9EEw1 M;Muu}tEU9EEw1lto;pwdl rFDu։Mpfƒ9vދUuD};pMI E||Mft,}ЋMuG+L1҉u;Er}u EutIM}ɉ}EU~ E;pE;~{V1r&DM}}̅hdD$ <$T$ L$E=Oxt\\xD$D$D$ D$D$$t @ @fEt&fEt&Uȅ`XED$L$$UȃE=6==t&=v у)=UȺv ҃`EЉtt&dhtD$ T$D$ $U)UtEEvMȅuhdD$ <$L$ D$UX`T$L$EEuD&UȺ0D$$PfEfUȺED$$t$L;EEUE~usUMD$T$$|EPPPЀ <_}UȺKED$$踮$;EuUMD$T$$޳_PjP^PЀ R<_F$ERWUȺUR |d$ETD$D$9ZTEE$,M<҃i9MUE9Eu}ЍUȍM}}UMuY0tuE;uEa;}tJMU|$D$D$EL$D$T$D$ E$uERUEo|?U։$PD$t$bPẺD$ED$$69tv9E;}tJuU|$D$t$D$ED$T$D$ E$uuUE{EE9EE7}UMD$ $T$ L$2{;uf9E9f뢀}sfEfer}s&ԺVt&jLfTujEډ$E)TEfEUM<89UUUu}ED$P$葪PTDB tuUEzMEuE<89Uq8 tTD$$T=WETD$$$Tb뀋EUM<89UUEUXED$P$聩PBEEME<89UD$$9=vED$$$uMtUUExnu낋ED$$֨<_u_D:UEM<89UUUUuUHt&tUUExMEuE<89Uz8 tuUD$t$T$zTu뮋?}EUM<89UUuUUUItU)UEFwMEuE<89UuUD$t$T$跬Tu볋UȈEEE9E\EEuuEEE:EDUtEAUE^v.EEUEU M429E vML$E$D$RxD$E똋EUM<89U[UEUyZED$P$PBMtUJUEgu7uEME<89UD$$膥=lED$$h$@uE럋ED$$@<_u[E}U<:89UOUEUuI tItqty EEuE<89U uMtU UE=t MM뭀xuP~ uxP]hxE}U<:89UVUEUuVtbtjMtUkUEsXMMEuE<89UQwE΀xuxu@X<拓:UEM<89UUuUUUJ&tUUErMEuE<89U*uUD$t$T$/Tt볋D9M' E}<89UUuUUUquUD$t$T$貧TuHtUUEqMEuE<89UB8 u֋E}U<:89UUEUu7 t:tbtjEEuE<89UQwMtUUEqMM몀xu떀xu@X<E}U<:89UMUEUu2tbtjEEuE<89U QwƋMtU2UEOpMM몀xu떀xu@X<EUM<89UUEUz萯ED$P$%PDB MtUUEoluEME<89U8 t>D$$趟=fED$$蘟$谙wE떋EUM<89UUEU薮ED$P$+PB MtU{UEnhuEME<89UD$$跞=aED$$虞$rE뙋; ñX9MQ E}<89UjUuUUUItuUEmnMEuE<89U uUD$t$T$Tu볋X9M`E}<89UUuUUUItUUElMEuE<89UJuUD$t$T$OTt볋E}U<:89UUEUuq tqtuft{fMtUUE lMMEuE<89Us uEрxuP8vuxPex뽋EUM<89UUEUED$P$芛PB UtEUEjuEME<89UfD$$=dED$$$#rE뙀xTx4$袬EYE9EU}uȍMЉ}}uUM=0M;uMuoE;EtMML$UMD$D$ET$ D$L$D$E$ֿuUiU։$PD$t$諨PẺD$ED$$9tq9Eulu;utJMt$uD$L$D$Et$ D$D$E$(uU iEE9EE}uUD$ $t$ T$耶4$Ea[xxcDžl[ẺΉD$E $D$U$EEȉD$ED$tMM9ME1҉}E}9r틋}A EUg1E9EfuIUM$T$L$^uMEgmE9EE9Uu}tÀ"uUM$T$L$t뽉4$&ED$D$4$EAv AE< t&E9ECEE4$虱E1}E E U=AvAw E:AЃ _ EAЃ _ E 贺$vt&Ӟv@P <!=h$*u@t&!l|@P < \$Ғ1A 0ݹW$t&v賹W$evcv苹$M蘨t&3^$иkzEv.$蠸;&'UWVSU E}ҋ0t U B uLV$сM~@}V$EG @ tU+U9V(~@1ɁĜ[^_]ÐV$сM~@}V$EG 벍E t E @ \EEM}OF4H4ɉME9MvN$MP(U@8EMEEUEE}UU)ЉEEEv}MEMt }}ЋM MIMȋ }9M y3} 2My99!}O +EMԋ}ED$L$ T$D$E |$$gEtF't U +B EEԋEt M}ԋ8}ԅ}pF4H …hx XM̋}E}̀}}WH ;MMy fM+MMЋ}x+~(+MEMH9M}}MЉMȋMH}B ;tKU;MBM̉D$T$ M̋@M%=)BȉD$Ẻ$;;}Uz EЃMȉM̋}vUUԋUMF&<E+EԋUMD$<$T$ L$Et&F4H0ɉM2H4'U ]F4UH0M }u P(MU@8EEE M+HMH0U[F4UH4MfEʉ$E9EȋF4M€y JPE$Ej9V4}:B5vF4H…xvHU);U|}lj}xt&U}Eډ<$8EЋEx  F4}PE+V(<$8NjE@ E* UЉ<$T$#EF4NMEЉ $8M<y t4MHM $c8NjEx tUԋMEډ $E8E+EMy ?v4uMA0}t}G4@ut&Eu M H(MH,9MM9@8}EM@EԋE HtUEMT$$ M1M)E);UMUEE}&} %@,M‹EHMډ $ 7EЋF4P,M+M9}t-EHEډ$E}7El9EcF4UԉUȋUMЅt^EMЀy tRM+N(;MUЀ: UUU t&: 9wMMSMЃ&}@@4@E@EP<=EwQyvvwQywQywQxht&gv]vtyw wGqxW3q%Q뙍t&t뺍&It&vqwQ'vvUWVSu 艤E|$t1f 9u[^_]Ív€?vu[^_]ÍUWVSTUЋ@ @EЋMԋ@ t@E̋uu}ut }U҉Uu4$$EHDM}A G 09sRM̉uuMMMċMM 9t&vuM̈9wuEUpJ M@ PUp 9։UE܍U؉EU}D$ 4$E)|$虓M}D$ 4$L$‹EUD$3UNjE؅+  w}t M}1ҍrUDu9U}9c9}ԍv9}ỦuuЅ҉+UUUM4[ a;Er}t9}fU9}v~uLjՃ} }EЉD$}$SvMM̈H=MĈMԈHMHM̈Ht r9uoU@ \MPU@ EUču܍E؉UuEt&M9MvT΃< EtY}D$ 4$)|$}+tR}-tL}&tF}!ft>tEċM9MwEĜ[^_]Í9uv< tE듍t&UUt ǃ)EċMt$D$D$ $D$ |$D$D$D$ D$D$ ƋED$D$@ $@ x9}U$U1E@ @E؋q AUB MPU܋A EuK}uE9U}&Xf}!fU$f_>9ЉUsۀ}+EEE}}uuvMt֐> uU̅t}ubu }!tNt}-tBt}&t6uuԋE9EL}tEME떍v1}t8}tB} uuԉNNFu뗍&MԈM냍vuԉFuhUED$$D$6UbuED$t$$ƋED$$}}+t;}-RJM1Ʌ@ U܍r҉uu"JM1ɅU܍r҉uuJM1ɅfU܍r҉uuJM1Ʌ U܍r҉uupEċMUE)E؋ED$ L$4$D$aUEԋE؅}Ԁ}L< < }/U t$$T$-t&E199E lju+}9Eʾu 9EsӋuu4$蒁EHDUB EVT$D$$gg;Er'}t!}t&9}Y)DM)։ B JJBuD$$p{E|D$$X{EM~oE$D$D$$6EUT$D$$UUT$D$$UEEăMUE)E؋ED$ L$4$D$(U}&~$(8~$}$ MD$ $L$EwVy„t똍t&J FExhNɈMY}OVC띐t&B<fwPVV VKvFfwVỳ„tfJ NɈMxwNɈMy}wVyv먍t&Jt&wSVH?V3*VMvVUvtJV҈UvFVqvUVSE גDuu4$q9s)>y v8t&x9w9[^]É&UWVS|8D$ lD$HD$$,o[^_]Ít&$ičlD$$,roʐ&USUE eҡ9rT$$q[]fD$$p[]ÍUWVS\EÃ8$,jU ҈E֋EEuJEuDU1ɿEEUEtP}U1\[^_]ÃEtEUU؋u؃\[^_]Ð}} TED$D$$MہMЃ}E`D$ D$D$U$MSMЋEp dPffmU8ҋD$ Ht$D$$,MidMЋuUD1 \[^_]Ðt&EnU܋,fU1ɿEEv}MEzE@ME UEU1ɿEEU&U؉T$UD$ ED$D$U$MOM} |{DЋE؉L$T$ D$U D$T$E$yOM qot$D$U$MUOMMU9UUč{+U|L$OE؉t$T$ D$UBD$|D$E$MNMt$~D$E$MNMt$~ڃv2v(vvv ҃|{DE؉L$T$t$ D$D$U$MBNM:fMUEZvUċMEE.D$D$$M|E~t$D$E$MMUċMuEu8EtJk$MbM1 U3{t$D$$,M^ME؉D$ UBD$(D$E$MMM&USE~UD$ ED$E D$E$f[]Ð&UWVSLEU ~M@ EЃvуMMЉEÈ; D$D$D$ UԉT$M L$EЉ$:jt~B tvRUp teMЋMԈ Mԉ0lɉ1ũVt$s$,lyD$D$ <%D$ U $deu1҅M̉ $E!$d9 D$D$D$ $EԉD$U T$MЉ $(it0B @RUp tU9EL$s?ʀMEUM "vE MTE@?Uȋ; /;E}ԅ- 0lUzt&U!t& wUȋE D|TL[^_]fD$ EԉD$U $T$tMUt&ED$D$$Qzf4Q SUȋML[^_]ÍML[^_]ÐUVTVL[^_]Í&Eԋu 9t&'U8]zfuƉ}׉$bG1tt,D$t$$J]u}]ÍD$D$ D$ED$}$9J롍'%ϕUEU7&%UEUh&e%oUEU&5%?UEUx&%UEU w&$ߔUEUG&$UEƁU&u$UEفU,&E$OUEU&$UEUl&#UEU|W&#UEU'&#UEU&U#_UE Ud&%#/UEUP&"UEUlg&"ϒUE%U7&"UE1U&e"oUE=UP&5"?UEJUX&"UERUHw&!ߑUE]U0G&!UEiUD&u!UEuU$&E!OUE}U0&UE !8_tU=wMȉ…t< j< <\< bft&ED$ D$EĉD$Uԉ$AED$ D$D$Eԉ$A:t&}ԍD$ D$D$<$kAG L[^_]Ë}ԋG L[^_]fU됍v\^rNt>a.nUS$UE EròT$UT$ RT$@ D$E$ B$[]ÍUWVSuzpw[up9uT)EEp)EEEċpM0}:u<u8tt&Ĝ[^_]É+E9)u}u*} ƍ})9EЉEE}딍t&p}t:t&},}t MuE t&p}E붍MuD$U4$uՉD$M@}ED$t$<$':U&MuD$4$uΉD$@}E܉D$t$<$9u]}QuMx}9}t }fE9Et }fR} tMU U1<}u>/}됍}t&fuv}t&f]vU]Ee#uu D$D$4$>Et$4$D$8]u]fU]EfeӀuu D$D$4$>Et$4$D$4A]u]fUS$EeÅD$ED$E$-<$[] U]EdCuu D$D$4$>Et$4$D$$^]u]fUS$EdD$ED$E$3$[] U]EFdóuu D$D$4$=Et$4$D$(]u]fUS$EceD$ED$E$}X$[] U(]Ec#uu4$D$D$<4$)]u]Í'USnc~E$ /[]Í'U8]9cæ~eE1EuuD$4$D$l<4$UUe3u ]u]USbK~E$6[]Í'U8]b~eE1EuuD$4$D$;4$=Ue3u ]u]USNbû}E$>[]Í'U8]bÆ}eE1EuuD$4$D$L;4$SUe3u ]u]USa+}E${<[]Í'U8]a|eE1EuuD$4$D$:4$PUe3u ]u]aUS.aÛ|E$I[]Í'U8]`f|eE1EuuD$4$D$,:4$MUe3u ]u]US` |E$R[]Í'U8]i`{eE1EuuD$4$D$94$d:Ue3u ]u]AUS`{{E$Y[]Í'U8]_F{eE1EuuD$4$D$ 94$NUe3u ]u]US~_zE$kC[]Í'U8]I_özeE1EuuD$4$D$|84$YUe3u ]u]!US^[zE$Y[]Í'U8]^&zeE1EuuD$4$D$74$$Ue3u ]u]US^^yE$U[]Í'U8])^ÖyeE1EuuD$4$D$\74$PUe3u ]u]US];yE$@[]Í'U8]]yeE1EuuD$4$D$64$0Ue3u ]u]qUS>]ëxE$;[]Í'U8] ]vxeE1EuuD$4$D$<64$$Ue3u ]u]US\xE$A[]ÐU(]Ev\wM u}:tO\ D$:;>t<>u H>tXT$ L$D$$'D]u}]Ð|:;>uH̓>E뒉T$L$$QUWVS[wL$P Jt A MԋR E‹@MЍP:H3T$$/EԈB @a6D$D$D$ D$D$ T$D$$6St1t+@D$e$Ht @ B @2tD$D$D$ D$D$ UԉT$D$$Rtt @c~Ut&74$K8‹A @D$D$D$ T$t$$Et;t@t$RftMt$ $-7nL[^_]B:MB:AB:A D$$-UD$ $eFUȋ@ @&D$E $FP H$R@ zHMp 9Έ^P>P2PЀ &<_y}̉ωUf9PvPvPЀ v<_t֋MD$ $#u}9ED$~$C,$ Qu fND$6$,vND$Y$+D$ $D@ @?D$ $D@ @9ML$UD$"$UMUȉkU]Ít&'U1]É'U]Ít&'USV+r$P;t!MT$$:1[]fLuЃ1[]ÐU]ÐU8]IVöqu}E䋃 4<0A tdUI )‰uOA< uHu'21]u}]fx10׍$KUU]M uUp@(tZPt4@ t.0@ v DtD$̄L$ T$$qKބL$T$$ZKfL$T$$BKv'UWVSTYp 0 )‰)~r}8~F$D$))|$<$D$d6=8wG$D$)0[^_]Í&t$4$D$6s|D$E$I&UWVSSYo, 88<),(MR }A A @ @ I$D$ D$D$Q )ЃT$$D$M5M‰ $zUF"UB>,[^_]Í8>,[^_]Í&D$$UGU@t&M8>늍|D$E$SH}뀐UWVS\Rm, 9 )4(rU A Q B JɀRL$D4$D$R$1)t$4$D$U3UƉ$~ F8,[^_]Í}8E,[^_]Ít&$D$pE6E낍D$E$FvUWVSP9l, 88<)$(MR}A A @ @ @I$D$D$Q$)ЃT$$D$M2M‰ $zU.UB>,[^_]Í8>,[^_]Í&D$$UCUHt&M8>늍|D$E$;E}뀉'UWVS14)҉}~@D$ D$D$$P Nj0tu)~&V<$UFU,[^_]ft$4$D$l-‹,[^_]ËE䋓u̍|D$E$@v'U(]Jffu} 9  )(tdpt]D@ tS@ @ t8@R4$D$ D$D$R ]u}]Ít&D$$>뻋xD${$v@'D$E$@'UWV1S Jwe :(tp)}ta@ tU@ @ t2@ID$ D$D4$D$Q [^_]ÍvD$$=빋xD${$? D$E$?'U(]IÆdu} :7:<)(txt @ u7`8<]u}]Ð@ @ t/@ID$ DD$D<$D$Q D$$<뼍D$E$>xD${$I>U8]Gfcu} 9 )uYU$ 'Ut#x]u}]ÐۍD$E$4=UWVS t.t9E]u}]ÐG tbxfT|BtTtn@OxME䋻fߍu3tN Єug뜐p؍t&tԋB 80Ő$9뵉'UWVS@)\<8 2)U(R @$L$ D$D$P E؋U؅4)ƋE؋@ E$Exx1}"@$%EE9E|OD$UT$E$#v)t$4$D$!딍t&U؋BtVB2<[^_]Ë At2@ t&E؉$MtvHu <[^_]É$p [v <[^_]t#R&G $Ufk7UԄ$A 80t& ̈$o4AD$E$3fU8] >vYu}  <U$6$ U>8]u}] U8]=Xu}  |<U$;6$ U>8]u}] UWVS =yXlEЋ  ʉMȋM)ɉM  }EE9UYEEEċ@ tG@E@ EEitWodED$$2t&ML$D$"$U:UEEiu}uu}uBEt-HoIE&9U-Uи+EԍUЍvMЋP tt H y @UȃUt x Ml[^_]Í&}ufBEIHIE#@ 80E t&}lu_VBEHtiIE@ 80EVEE9Uut&2EẼu9Ug5u3EE9U3t&HEÃ9Ut&pẼ9Ut&xẼ9Ut&@ @}@$19Eԉ$.Ƌ}EMMMv)E})`E})E}ElFD$D$Eԉ$zD$FD$Mԉ $U[ED$t$Eԉ$AU҉@ E‹EЅEЋE@ Eąu@EȀ}}})H@$MME}fx)}D$D$$3Et&ű}ԅt MԋAAu $~UD2l[^_]Ít&tD@ 80Et&D$D$$HvE&Et&vEt&vEt&vEt&\vEt&%v}t&u&){v)EЃD$D$n$M1$M;@$vEЋB% D$@D$B $M2Mv|$<$D$MAM&@$M]MHt&|$<$D$UMMU |$<$D$MM4&|$<$D$UMMU@ [|$<$D$MqMd&|$<$D$Lt&|$<$D$UM&MUEԉ$=*$Uf,UE $U,UE&$U,UEGD$E$})t&U8]3N}u 22<4:)u,D@ $l8:]u}]Í١D$E$(fU8]2fN}u 22<}4)4:> t/E]u}]Í&D@ t6@Gu7$$EfD$$x&뽍G$R$JEd&U8]1FMu}>E䋃 B @ tI@})׃U>M$$M]u}]Ít&U܉MD$$MU랍D$E$&t&U8] 1vLu}>E䋃 B @ tI@})׃U>M$$M]u}]Ít&U܉MD$$ MU랍D$E$-&t&UWVS<0éK, 11M )Hz MM M1ɃuMD@ tTHE܉L$$u1$E,[^_]ÍxD$$#띍wD$E$6%&'U8]9/æJu} 9  )Ed@ txH 4$D$D$z"4$D$UF @t4$M䋓4E]u}]Í&U@U܉뇍D$E$$$U8]).ÖIu} 9  )uZE$,u4$E䋓]u}]Ít&xʍD$E$c#t&'U8]i-H}u 22<4:)u)D$$8:]u}]ÍD$E$"t&UH],FH}u 117 )4 F tk@EF F u"x7]u}]ËuUЉMԉ$t$UЋMԄu7 fEUЉMD$"D$4$*MԋUxD$E$!t&'U8]+6G}u 11<)uq<B uE u&>:]u}]Í&x>8؍t&$U-UB뤍D$E$ t&UWVS*iF<E u y})։4|}܉uFtvUD$V4$U؅t\U؉4$ $U؃Euxuܹtf}܉UD$<$D$E$UD$F $%"|$<$D$MIMW&T$$D$$Ht&E0E&t t&$v1ɍtB 80fUU U8]y5}u 00<)yUD@ tL@ D$$uu)E]u}]Ít&xՍUD$"D$$mU뗍r$fUh}}]uu 4G tE D$<$"tt$$R¸G xf<$D$DžP G D@E4$tVEu-thU rB+M 1$t$|$]ÍvM at׋U fB+ʍvU r뺍vhwt&M w뚍vU]Ít&'UEU ]@ DÍ&'UEtt@t@\]Ít&1]Ít&UEt&t @ @t@tPl]Í1]ÍUEt&t @tPdtHh]Ðt&1]ÍUEtt@tHl]Ít&1]Ít&UEu]Í&tUfz x`1]Ðt&H1]Í'UUE tHtBR taHt@+H]ÍtrHu]Ívu ]Ít&Hw]Ðt&U1]É'U1]É'U]ÍUEtt@]Ðt&]É'UEtt@] Ðt&]É'UEt tH]Í&U]Ít&'UE]@ ÍvUVUu t"tu^]Ð^]ÍUE]@ @ UE]P B+B Í'UE]@ @UE]P B+BÍ'UUE R tB]ÐB+EB]Í'US~$U8E]}} PýD$Eu1ID$ED$ D$t$$~9v ]u}]Í$4USED$ E>D$E D$E$[]Ð&UMVS#t=It8rt>wt~atGbtbtt]uyus[^]Í&ruƒ11+uǃ뽍t&1A+uBbuQf1A+{sxt&'UVSEM $BɉBuvlt @BW t"E GH]u}]Í4$8ԍ&'UE]u0V tF]u])Í$V ލt&'U(}}]uPýJ օt 1B tF+F]u}]Ðt&<$ԍUE]u`0V t F]u]É$@鍶USE%t/t)RtRXt $҃[]É$8[]f []Í&USEXt/t)RtRTt $҃[]É$[]f諼 []Í&USEett`t$d[]ÍUSE%t/t)RtRPt $҃[]É$[]f ؍USEXt/t)RtRLt $҃[]É$[]f諻 ؍USEett@[]fc 捴&'USEt7t1RtRHt $҃[] 荶 Ѝ&'U8E]u}8.ÛW O1t@W(t: t"B+F]u}]Í&Vt&F9sY: Jui}}FJ9rvF9wF n F<$9N F QV VA t}䍶W(sFnt&뇍t&$E8*9 }u W(뻋}ЉW(+F,&USEut7t1RtRW tO$9tE$EG GGb]u}]fUWVS}f t]uRW tCO~41҉Pt>W 9w~DtPu܉$Df$h<$`[^_]É$W 븍vUE]u@ 0F t ]u]ÍvF u F fD$$F tFFF ]u]Ít&F$F F ڐU(}}]uPý 7F tF u%F0F <$zF t#VVt]u}]f<$pV0V ӍUSK D$$[]Í&'UVS t%Ⱥ@t0u[^]ÉD$$@`t݉֍'U1WVS,U$ÑUPE EEuat&}9EOE)$|$‰D$E$UZt$UT$U$)}}uU$}}~ u vuE+E ,[^_]ËE$tPˬ ,1[^_]Ã}멍v'Uuu]pt2t,Ht5ED$E 4$D$觭]u]Ðt&]1u]Ít&4$ UVSEM ut@t:RtR,tt$L$$҃[^]Ét$L$$ [^]Ðӫ ύ&'USË$ED$ED$$̿M¸D$[]Í'U(]E3u}}$9O1~D$E D$E$‰9|]u}]ÍtE )|$D$E$xfuf빍&'U(]Æuu}>4$qx $euIt$!уtGWE4$D$ ED$E D$E]u}]ËH묐t&USEtt@ t$芩[]Ít& 䍶USE8å1B J t $[]USEu@ $&[]Ð&USEE@ $F[]Ð&USE@ $[]Ð&USEx@ $[]Ð&USEHõ@ $v[]Ð&USEUÂD$ E T$D$E@ $豺[]ÍvUWVS,} E@} &U@ D$$D$ ED$gy)8u tErE뭐t&,[^_]ÍUWV1S,EDñ}@ E f}U蹧8uKuPtUE|$D$D$ U $?ƃuE$ uI,[^_]Í&EE룍vE$ tU ,[^_]Ít&X&'USED$ D$D$Nû@ $[]U(uE uU]EÇU@ H t蒦]u]Ðt&ED$ EU $D$T$!уtƋ`1]u]UWVSUx t&EU <$D$T$2y5utOŐt& t UH[^_]Ðt&UWV1S,UÁ}P U@% =t,[^_]|$E D$U$}Nu?0t뾐ut&tUH,[^_]Ðt& zUHiU(]Iöu}>t t$]u}]Í'U1SUSt$Ÿ[]Í&U]&uݳt$D$$t$D$$]u]ÐU]YuD$D$ $CƋE$f$t$$]u]UWVSi<}$ %EUЍUUfD$$NjE@@ UD$D$$ЉẺ|$4$vẺ4$D$gE@$4$D$MEt4E@t @gE䋻@svE뎍v<[^_]Í&'U8uu]}}:VF9}.F ЃVU xtG]u}]Ðt&V Ft;EEm؃tz݃wO$D$VF 됍v1ɉEMm؃tz݃w$^VF XD${$;vUWVS,uSEt@豧EF~11t&V BD$E$T$9~֋E,[^_]ÍvUWVS|,E E䋻uz08u \;t,[^_]Í&|;uٍ"$谫tǀ8tD$D$A$ߦt&~$PR R @D$6T$$pƍED$E4$D$F tBPUF T$D$$%FtNF4$,[^_]ÍED$"D$4$U뭍t&@/\f4$8,[^_]Ð&UVSUTxE9}a 1~61Zt$$T$2[^]ÍwT$$>t$T$$D$T$$vUWVSUFó@ p tf4$.~U`1[^_]Ít&f4$t臞8utt&ِ[^_]Ív[ 뢍UWVS,Et1t|RtRDt$҉ǃ,[^_]1,[^_]Ë1t&EtՋEuEt&t4$迯E;uuE뻉D$$薞葝 t&'USEEU~D$E $D$詪[]Ív$8[]Ív'U(]U MuuUM4$EUM4$D$ T$L$ݩ]u]Ít&'US.ÛE$諮1[]Ít&'U(}}]u]7NFV  t"~ tN)]u}]É<$8$讥FVč&'U8]E vU}}uEU<$t]u}]f`EUD$ ET$D$$訨u?<$GW믐&UWVSLUSMx ƅPUhlU EUt/U 9U s%z zt} E z Bt9rE1EUU܉U&f~F F 9UPU~ +~~ U9N9UvU܋U+UĉU؋U9UF}؋UPtF|$Uĉ$T$M}M}})~~E9EkU$MBE~MЉEċF F 9QU$MMЅ@U}ԋ@EEuXL[^_]Í1L[^_]Ít&E$MʫMЅuۋUPUU EUpE$蕫L[^_]Ív$M]UMЋ&U(}}]u-7F t*F t$E<$D$E D$]u}]ÐV,uuыF0t&F Ő<$1uʋF uڍ&<$t&質F F0돍vUWVSt%D$ D$T$4$*t*FVN+M܉M}+EU1ɉFVtU:<$o1ɉFV#v'U8]9æ}}u7<$1‹F t N,uF0]Ћu}]Í&U<$}UEЍUSE5J(t  B($踠[]Ív'U8}}]up 4$膔ti$Y~]1;2tB;0tW<;0tM<$车踔F84$UUt1]u}]f4$獶<$p׍c 뿍&'UWVS,}tl7tf<$‹`fHtI@u"`6tu߃,[^_]Ðt&4$UыUEЃ,[^_]輓 &U8] vuu}4$>W tO$9tE$8EG GGb]u}]fUSEt/t)RtR@t $҃[]É$H[]f ؍U8]U6ã}u2$U认UNjF0tF F0FF$J]uE}]É'UWVS9,EtQt&u}&9t$t@%=u4$9u܋EEu,[^_]Ít&U8]Iö}}u7<$¸ud@ F OFF'4$觞uCF D$F4$D$譥…V VH1]u}]Ðt&4$蘩~jU4$跽UEF N $E9NʉL$M܉D$M܋UE4$)ȉT$D$3M܉nS$4$Аu,4$…xt>HAv4$E蕸Uủ4$ƩUt&Ht&<$(F &U8uu]}4$EuEP t.@ t]u}]Í&4$踐⍶4$t΍v'U(uu ]E}}}x;w|t7]u}]ÍvG @t$D$$YG ɍ $t&'U(]}uuXt?t$$D${t$FD$$]u}]Ðt& U(]Æu} ::y )t&@ t7@ D$$RD]}u]Í&D$"D$$8벍&'UWVSLU fUԋEԅhXHɉM~@@ E1U؋}‰UJUԉM9҉uUMԀ< 1;E|ɋ}KT2;h+x!`?شD$$&UԉT$Mlj $D$D$ƍ$蒷E`$EЅt $EЋ@`D$t$ D$|$$k`(EEE$0EʋML$ ET$D$̴$FEL[^_]ËUԍߴM$T$L$EEL[^_]Í0$&UWVSp-FuXt>UCҋUEET$D$ F|$D$J$F]u}]Í& tD$$rCMɋMEEL$D$ FU|$D$J$JUB@sUMt$ <$T$L$ЅT<$1萛EvMUt$ <$L$T$Ѕ#1$脳UWVSLu$&Ó} t $TU<$T$D$UMU MHɉMM,L$$M(t$L$ M L$ML$ML$MT$|$$L$ UƅtME<$D$؊D$ UT$M4$L$4$辣u}Iu HL[^_]|똍vEE@D$M<$L$U,U܅tKHɉMtAM,L$$M(T$L$ U T$ML$UT$ML$ U|$$T$U…u1L[^_]fM@@EL$<$މUT$ D$M4$L$U$붍t&4$1螘UVS=ê u4$:4$D$ щD$UMD$蜐UMPHE4$D$E D$X [^]É'U8E]}}u0諺F F U A N ȉFFU1ҁHF )FV9Oυ~}FЉFu 9tL$M܉t$$͗M܋U)ω΋`tE U|$D$$0Ɖ]u}]Í&N)9Oυ1뼍$X'vU$%F 1댍&'UHE]u}~B ukBt +EE;B s1z,ubEU MD$T$ $]u}]Ít&MƋ} 9uEԉBU`EʍvU$荋U녋MU $zUr uB0tB wEU$3UB B0['UWVSD$<$菋9tËUT$M L$E$蒁EE,[^_]Ít&UEuNjE,[^_]Í&E$腗먍t&'UWVSt4ɉ$Ut$KyU]Ћu}]ÐE M$~Mt8uɉt΃vƍ$UUxB @ ?eD$D$$lrUoUT$Nj<$D$/1D$<$ؒ蛃vv$t&1  t] fBD$D$$q…St&uD$$ jsD$D$$rq묍D$D$$Pq늍t&UXuu]À}59}GD$ɵt$$Rh]u}]Ðt&E܉D$ T$U؉Mԉ$t$hE܋D$$oU؋MԅEE܉M)ЉE܍U܉D$E؉T$$gU1ɉME؉Um؃tz݃|zUD$$T$tD$t$$t$$򮋃@эytx tA賜$|$t$$;r$蟀D${$藛@ @t@ u몍v'UHuu]eE1Å}} u!1Ue3]u}]Ëtى4$jwt~?ty4$9|$$-ztE܉UD$D$ 4$D$+ztEx UЉ<$d$]UЋUԉWE܉D$4$qfEԉ/Y'UVSMÄt9PuG&9Pt;uD$ $ qt$cx$u[^]fp [^]Ít&UWVS<} eE1E舣U|$D$ET$ $tSP $UscUEEuOE܉D$<$D$Eԉ$xB t$8c$Ue3uC<[^_]f$c$~xE܉UЉD$<$耍UЉ$D$1xfUWVSLU u$E蠢 }UЋMeU1҅EԋE,t U(~/@ G@ ?#u?U $T$UT$.i<1Ue3PL[^_]É|$$tYD$ t$T$$utx U<$_$GU]Ћu}]Ðt&<$R_${t$E$tt$yqfE䍳t$$ctu؋E䍳t$$JtuE${1pU8}} M]u蛞r u1y,]u}]Ív4$UMZzMU1xԋEUL$ |$D$E$近UtJr JE4$E땐t&UWVS,u$s}UMtt @ E(~T?#f<$U'pUE t-E,@ @ U L$$T$M~dM…xm1?IDžP H$KH ?atE,[^_]Ív뀍v@4$UMP@MU:1,[^_]Ít&4$D$ D$D$,[^_]ÍD$"D$$MmMt&UM%UM"ED$E $UMj|$D$ E4$D$rUM &U8E]6ãuu}} D$ E4$|$D${Et=$nt <$Jn‹U$KA UQ$踍H E]u}]Í&UVS蝛 $]$k$_$S$[$Im$=m$1mXt$=ht$#[^]Í&'U8]}}Ӛ@uuCE΅tB@UD$L$|$T$U $T$ \t+t$D$<$_\]u}]fLD$ D$<$D$oōt&UWVSÉ,UEtl}܋E܃EtPBuƋu;}t0ݐt&BUD$$>[4$6l4$w봋E܋Eu,[^_]U8uu]s}} t|tv@%|$t$$EZEt3P(t,U謓MU|$t$L$ $ҋ]u}]胓U|$t$T$ $lfsY 1vUED$v6فH[w}E fEm]mEfÍt&فP[w1Í}E fEm}mEÍvCUEفv2فH[w}E fEm]mEÍt&فP[w1Ít&}E fEm}mEÐt&CUEفv2فH[w}E fEm]mEÍt&فP[w1Ít&}E fEm}mEÐt&UEjBtv6فH[w}E fEm]mEfÍt&فP[w1Í}E fEm}mEÍvUS~EtLtF1ɅxZكivt&҅t1uلt[]Ívz[]fÍ&[]t&Í&ع UH]ٕFu}tZ$ ;dtzI t=@ tIMx uu 9Uw9ɉuEԋuvU9E v8.t1]u}]fM␋4 |t&ML$D$$蹓Mk&UWVSYuu4$#sDEfu< t< t< t< t< t&t<+@<-E!EED$ ED$E D$E$wU Et E0[^]f1҉EUm0[^]ÍUWVS\E UÆ0u8Mu;11U 2M\[^_]ËMybuv1EM+&҃ B ȅtvtoJЀv?_}VUVJЀuЃ}t0UEu}݃U +u2M}t Eؐ\[^_]؋M$L$EĈU5nEEUEEmY_Mg҉T$T$$]EGEĀ}E>+u7Ebt>vF0.uJt&8D$$]GEƃ 1+uU1VS0uUŸ>EED$ ED$E D$E$'WU Et E0[^]f1҉EUm0[^]ÍUWVSLE UP0ƒU΋UUuH1EU EEԃL[^_]ËUzxEEАt&TUЃCxEEU=&}3U+< ЅEԍGEtZGtRD$<$]zNE}Ѐ}t +<EGEEu}݃MEЋU +EEEEtUEؐt&EԃL[^_]Ðt&U<_}B׃D$<$]MEt}؋U$T$EjU1ɉM܋EEUmEED$ ED$E D$E$vU Et E0[^]f1҉EUm0[^]Ð,U]ف,Ív'+U]dÍ+ϛU]dÍ+U]dÍ+U]dÍU]Ít&'U]Ít&'USK$ x[]ÍUS$ w[]ÍUS~$ w[]ÍUSNûED$$l[]Ðt&USËED$ $cl[]Ðt&US~[ED$ $3l[]Ðt&US~+ED$$l[]Ðt&US~D$d$>g[]US^~˙ED$$g[]Ðt&US.~ÛED$$f[]Ðt&US}kED$$$f[]Ðt&US};ED$$f[]Ðt&US$E}D$D$ED$ ED$E D$E$I$[]É'U1҉S$EF}óxED$ E MD$D$D$E@L$T$D$$au$[]Ívز뵍v'U1ɉS$U|CxM}D$D$0D$E L$T$ D$D$E$t$[]Ðt&ڱfU1҉S$Ef|ӗxED$ E D$D$D$D$ET$D$$t$[]ز뵍v'U1҉S$E{cxEMD$ E D$$T$L$MD$ED$L$$t$[]Í&ز뵍v'US$E{D$$D$D$ED$ED$ED$ E D$E$s$[]Ív'US$E({ÕUD$D$@D$E T$D$ D$D$E$Cs$[]Ðt&US$Uz5}D$T$ЃD$E D$D$ D$D$E$r$[]US$EhzՕD$D$D$E D$D$ D$D$E$r$[]fUS$EzuD$D$D$ED$ D$D$E D$E$&r$[]Ð&US$EyD$ED$ ED$E D$E$L$[]ÐUS$E$hyՔD$ED$ ED$E D$E$]$[]ÐUSE(yÕD$ D$E D$E$5m[]Í&USExUD$ D$E D$E$l[]Í&USE xD$D$E$X[]Í&'UWVSLE fxӓOt&MEċhUhEԋhEă9u |m$aUD$EMD$ $WhTEă;EjMkh AMĉEO&L[^_]U(]ywu}hTB;| jB} < ]}u]Ð&U8] wvu}hTp;1u|jhPUԋu9hP9u4hUԋ ]u}]Ít&U8]yvu}hTp;1u|ihPUԋu9hP9u4hUԋ ]u}]Ít&USEuUD$ D$E D$E$5a[]Í&USE uD$D$E$N[]Í&'USnuېL[]ÍvUSNuûQ[]ÍvUS.uÛC[]ÍvUSu{C[]ÍvUSt[C[]ÍvUSt;qC[]ÍvUStU[]ÍvUSt1e[]ÍvUSntۏ9[]ÍvUSNtûk[]ÍvUS.tÛk[]ÍvUSt{qk[]ÍvUSs[F[]ÍvUSs;7[]ÍvUSs7[]ÍvUSsh[]ÍvUSnsێ:[]ÍvUSNsû13[]ÍvUS.sÛ3[]ÍvUSs{2[]ÍvUSr[2[]ÍvUSr;q=[]ÍvUSr3[]ÍvUSr3[]ÍvUSnrۍ3[]ÍvUSNrû3[]ÍvUS.rÛa3[]ÍvUSr{Q[]ÍvUSq[A[]ÍvUSq;qA[]ÍvUSqQA[]ÍvUSq1A[]ÍvUSnqیqD[]ÍvUSNqûQD[]ÍvUS.qÛ1D[]ÍvUSq{D[]ÍvUSp[C[]ÍvUSp;C[]ÍvUSpC[]ÍvUSpC[]ÍvUSnpۋqC[]ÍvUSNpûQC[]ÍvUS.pÛ1C[]ÍvUSp{Q[]ÍvUSo[qQ[]ÍvUSo;QQ[]ÍvUSo1Q[]ÍvUSoAe[]ÍvUSnoۊ!e[]ÍvUSNoû1m[]ÍvUS.oÛm[]ÍvUSo{T[]ÍvUSn[S[]ÍvUSn;!j[]ÍvUSnj[]ÍvUSn5[]ÍvUSnnۉa5[]ÍvUSNnûh[]ÍvUS.nÛg[]ÍvUSn{e[]ÍvUSm[e[]ÍvUSm;U[]ÍvUSmU[]ÍvUSm[[]ÍvUSnmۈS[]ÍvUSNmûe[]ÍvUS.mÛi[]ÍvUSm{_[]ÍvUSl[c[]ÍvUSl;ab[]ÍvUSli[]ÍvUSlai[]ÍvUSnlۇ!][]ÍvUSNlû!C[]ÍvUS.lÛN[]ÍvUSl{E[]ÍvUSk[E[]ÍvUSk;$h2d[]USk D$$02d[]Ð&US^kˆE$kZ[]Í'US.kÛED$D$$+/[]Í'US$EjUD$D$ D$E D$E$L$[] USj %D$ ED$E D$E$I[]Ðt&US4E$D$E QjþD$ D$ED$ED$ED$ ED$E D$E$/4[]Ít&US4E ieD$ D$D$ED$ED$ED$ ED$E D$E$/4[]ÍvUS$EiD$D$ D$E D$E$-h$[] USNiû$ED$D$ D$tD$$g$[]Í'UShkED$$1[]Ðt&USE h5D$D$E$c[]Í&'USEhD$ D$E D$E$D[]Í&U]UFhóM uD$ $9ʉL$f|DƉD$C]u]USEgeD$ D$E D$E$a[]Í&U]Ug#M uD$ $9ʉL$f|DƉD$a]u]U]igւuu Y+Ut$T$$\]u]Ít&USED$E !gÎD$E$]\[] USf[ED$D$$Z[]Í'U]fuuD$D$4$FZF tF ]u]Ív4$D$D$e]u]ÍUSE8få@ t @ []Ít&D$D$$d[]Ív'USEeUU @ tI @ []fD$T$$dd[]ÍUSEeU @ tI @ []fD$T$$d[]ÍU]IeöuuD$D$4$XE 4$D$W']u]Ðt&USdkED$D$$c[]Í'USE d%D$D$E$Lc[]Í&'U]yduuD$4$NQE 4$D$&]u]Í'U])dÖuuD$4$PF tF ]u]Ív4$D$D$b]u]Í&'USE c%D$D$E$C[]Í&'USExc~@ t []Ív$^[]Ív'USE8cå~Pt @[]D$$F[]fUSbk~ED$$F[]Ðt&USEb5~Pt @[]D$$V[]fUSb}ED$$V[]Ðt&USE Xb}D$D$E$G[]Í&'USE bÅ}D$D$E$|G[]Í&'USEaE}D$ D$E D$E$U0[]Í&USEa}D$ D$E D$E$0[]Í&US^a|ED$$s"[]Ðt&US.aÛ|ED$$cG[]Ðt&US`k|ED$$>[]Ðt&US`;|ED$$3.[]Ðt&USE `|D$D$E$)[]ÐUWVS\`{,4E |<$tQtsU 1EEEE܉EU+MT$UL$M؍$O+M=w9w9|?4$|$1Ju4$1WE,[^_]ÍME؉ $=M܋UUL9M MhEUM뵐t&U8]I_özD$=$u}*tgD$.$*tD$ $*txt0|$$&U)T$Ut$<$fMU]u}]Ð&UWVSu^zeE1:tt$<$cY<$U4$V>Cf}D$dD$<$g)D$d<$ƍlD$K))1)9Gы4Ee3upČ[^_]Í&~mWvt$T4]o$gS UWV1S ]wx6%UKUt:xutUG2Őt&uƃ[^_]Ív'U]y\wu,t0t*8.t=tiD$$,]u]Ív]u]fxutPtG҉Pt-]u]Ðt&D$$N돍t&$h=ɍ$빍&'U][wu>u)$D$n<]5]u]Ít&'U]9[ævu>u'D$$<4]u]Í'U(uu]Z@v}8tt$<$UtH<$Q4$7S:>Ct5f_4]u}]f~t뾍v$Q뷍&'UWVSYiul$|%Ǎ$p%E$_%t$$E:$Pt$$:EEt$REE$Pt$$R:EUȉ$QE$Pt$$:$Q}EUп$JMȉ $e#Eĉ$P$^AD$D$4$zOt#}D$D$4$\O„t 8$ $EE$v:,t UЉ$OMȉ $OEĉ$Ol[^_]Ðt&EEE}a@t x ;NTT$$t@t x .N|"T$$B"@t x UNUT$t$|$ T$$M+u""@t x XU0NUT$T$|$t$ $EԋйE̍ԹܹME&}ֹ̉uk}ֹt]$D$=U "UtA@t x UMUN)։T$ UL$t$$T$EMԋvU+u""@t x  UMUT$T$|$t$ $@t x LT$$UD$$6?1t/@t x 9L1T$$UЉ$LD$$16$MMȉ $E{LD$$6$MEȋEĉ$QLD$$5$uMEt&,w&@ @8@ 6&uu 1f$ yD$ D$$)Y1vE1҅tHUD$D$$Jt"M}D$D$ $J‹uЅtHD$ED$$Jt"UЍ}D$D$$uJ‹MMD$D$ $HJ}D$ED$$#J@t x T>J$T$$f@ @1@ )@ @@ @ @@ @ @@ @ @@ @ @@ E&@ @@ )(v)(vf)(J@ @@ UWV<M9rEt&9v50҃UvփU?ʀQ9w˃^_]Í&'UWVS,QÙl} >~kt&  J 0  >HJzɃ<  HJ? Hm}M~g}EEuJ}J0 UP}>PP [^_]Í&'UWVS,}Ppk9ЉE$(ts[f9EE t t t݀ t؀ t&tΉ8t^#u9ƐwW9vJ8 u 먐t&$)J념t&$]2jE,[^_]É|$$`E&U8]MOsjuƉ}}D$ L$)‰T$$6P@w*Ut"t?1]u}]Ít&'UWVS|Nil} UЋUE0$,U7JU<%EC;uRMEMĉU<M =v M%U~A;uEEȉD$ UĉT$EЉ4$)D$5UJw멍}ԅEto$,sI<EɁM̋89sF9}vAuȋu9v2Ủ)T$ Mĉ<$D$L$N5;}rʋu9uBuEt2EtKMgD$ DL$D$$M1l[^_]Íl1[^_]M*볍'UH]LhuƉ}$,nH$<)%D$ ED$|$j4UJwB=v,UE$*T$T$EԋU%]u}]ED$p$GB UWVS|E؋0HKNg` 9agUDE< M< E< =< v2< *<# ,c(U؋B %E9[mEЍUčgẺUȉM<<t&<> fu9wZv> t&t9wU12|[^_]Ã9vMĺ%Eԉ $D$UMUM pM Mtt&0zЈU w4U&= ҃DBJЀ v݉}؉GGDU ?x9w;} +EԉEċE܋U)DBE$1MĉEȉL$uԉ$t$E1ҋHUMm؃tz݃|z $|1uԉ}EЋE̋}Аt&H$P @(uŰM܋uЋ}BMLu9vUԋMȍ)Ѝ9wEE9}vB}f9u f9tD$$T$9}wЋ}ċMW)9u f9t}̋W}ЍL9M̋uȋ} &Q)Q$I(uUЉ$E6u؋ENu.J u^}ȋu)~ BUP N L[^_]Ëu؋rtr }؋J)MBOu؁NJ t}ԉ<$E 6M؋E늋} GL[^_]Ë}<$5Eȉ$5t$4D${$4t&UWVS<>éY<MEtU e5u1 $?P+8B Ht+ A$ݝXDžDžLC4@Dt"P+93I FEƅTvDt3tq$)?!ω;E}EĄx LuEUtt E+P9|Tx;}6%Sv DD$$2&$PT$|$<$%UĉP닋$+ Euąu EfH(t D$ $&1tn)ЀHE~Ot9$3$&93ЋUĉt҉U܍t&ƅHLD$t$R"LLpۅp~Lك݅Xvf݅XݕXw؍t&݅XED$$ݝ ݅ݕX$U&+P!P$ PA $P++C62P29$L2P@ @E82PIDžLƅTDuąTuEDžTHp& tTH9sЃu9THr9H0HƅHtHEGt$)91t}xG1+P-tP9$AHR*tED..EUăPD$T$$4P$+tu9 Lu3EƉ$ $%P HDuĉDh+Eq"t1ҋttыUčr҉u前 UąTF x&ƅH1ɀHtD"Eą!P҉U% !R(Eu! B$t9D!#D$$P؉$Ƌ+PD"P4$P}t(DTLfEčPUHD(D$D$T$$VvUtCUDntwUt{ PҋEĉpۅp܅XPUݝXH]ttfUufDnfUuffUuPP$҉T$?}t(DTLvEčPUfHD(D$D$T$$UtqU "pEۅp܅XPUݝXHjttUuЉ ȉс  …UwPP$T$DtTu&EčPUHtiD$D$4$D$TtMLt]݅XEEPUݝXHuttEuD$4$cLuEݝP P݅\$$DtTufEčPUHtiDTD$4$T$$tMLt]݅XEEPUݝXHutt]uD$4$[LuEݝP P݅\$$ }t(DTLEčPUHD(D$D$T$$UtsUtk v ffE߅f܅XPUݝX_HittfUuffUuPQ P$҉T$Dt(L} %TvEčPUHD D$D$($$NnT}T( }  1ҋEĉlh߭h܅XPUݝX HWt8tT}u%  Dž}mP P|$$-Dt(L} %Tt&EčPUNHD D$D$($$T}T } O 1ҋEĉlh߭h܅XPUݝXHWt8tT}u%  Dž}mPyP|$$}t(DTLEčPUHD(TD$T$$ $UtpS U { pEۅp܅XPUݝXYHkttUuЉ ȉс  …UxP*P$T$Dt(L} %T&EčPUHD D$D$($$&FTETEDN} o1ҋEĉlh߭h܅XPUݝXHGttTEllj%  ЃDNEYυ}UPP|$$tTL}vEčPUHD$D$<$D$TDnUthUtl ffE߅f܅XPUݝXHzttDnfUuffUuP~P$҉T$tTL}&EčPUHtDTD$<$T$$DNUt`Utb pEۅp܅XPUݝXwHuttDNUuʅUuPnP$T$DtTu؁t&EčPUHtiDTD$4$T$$tSLtc݅XEE؍PUݝX}HutPtU܉EuD$4$- LuEݝP^P݅\$$}t(DTLEčPUHD(TD$T$$ $fUtpnU pEۅp܅XPUݝX9HkttUuЉ ȉс  …UxP P$T$p$+tEĉ$+tLЉUąEЉ$$p HDDb@}Et11L"҃1Uă9׉UuـHj$;tD$‹Lb뤋$U)9@Љt}NEċD$ D$|$$gEăEt8 P9x tt&t1: @:t<9 (? T&tƅ(DžOt&D$$@vPPt$$(Kv$,tT$t$<%D$ $)ЉD$UJt+&t&ffUt&ft&t&t&t&t&  EEUEQU}fUfUw}!UPD$|$<$>PPP|$$S>ttjDt$ $%L t$$9Lpۅp}ZTЉPU#A EUQUQUQ UQUQUQUA QEA$EA(tyt$D$ $tMt&t9$HMt(A @Eq TT&ETL9u v9t(;Tv4̐)ƍF09TrҀ(%Dž B  B 80tD$4$4$1PPEăED$|$$'TD$4$(D$ $D$L$Ɖ$GVG F @EV TftL!4$LE+PPP1A DžLLȋ+F B+P]PPPD$4$L$rTED$}$Ev$VUąMEU (TEăE $$T $($UE ȈEE ʋL EUɈEm}NED$ T$D$ $EăEt9w)D$<$,1;$+tEeEE‰ ʉ%  ЉED/ttP++Me3 <[^_]ËPD$T$$Pt9r5<t$}EMD$"D$$MEt&'UWVSE*U e M1ɉ|d蔷ƋG $,IcWUA5d+|@A$l$\Iv@ rƃ@tHt3@u,?R  E 90AAA AAAAA A$A(lDž{@ {=N$T$PPz51~S|H t P B  ft$B C$ZDž$C$;%=SD$R$d+|RV$lw.|PH @ $T$% D$|Ht&PD$I$PDžLE0+t]) P 97.D$$L$q+BFFF FFFFF F$F({}e3=|:[^_]À҃ A 9Džr,pDžƉJt&Dž$.‹pG <{O%+G =ȉ ρ  Ȁ P<$ؾGP<.O A"% =YPD$D$<$P3P$D$OP$Hy|8|ct+։lj+$ 9E,9sD‹ƒu 9w܋;6+ƅthɉG G J6GكP[2؋tD$<$2fƒʀut)?DЉ A 9c$qlj+򉅜Ή$ƒυ &@ m"@fuf뻋0-Dž-)A ,@Q A h)ƅDžD91ǍAEЋ<NjG 9$,'EzD$ut$ $ҩ44$tm‹+<$wNj)ɉa&;N񀽜k4$蟦u‹+<$T$PD$DPz,t83,@(u,P$.@ *@Ή$8ƒ1υL$@ @'Dfuf뗋%Ή$菤‹n#@ @ODu듋%Ή$‹"@ o@Du듋h-B u*Hz B $DžƅEȃ‹pҀDp A 9+#HH(1ɍXƅtt&F9;t<$D$L$ )D$QB/=Hv H  F9SX"1t p)ω4$|$D$Dh+DžDž %Ή$'υB -ݝ;u H렋]"򉅜Ή#@=wXpυ@$@ uPD$$4P=vLP$L$EPLz$۟_X*B  'Hz B !DžtƅDHЋhҀDhp򉕠B 9$;OB&1ɉp1҉Ή4F;;s~ptP<$D$L$ )D$3PH+ljЃȀECF;m4t0B'ур'G1t h)lj4$|$D$腾X+ y'B (%@B B #$@ %(@ 'h)1҃Z‰)Ѕ‰~F;s>9v܋9) )ZBE+ȉ@ P$%tK9vG &t  9w拽9")9)Љ+w)؉񉅜+<l$mRIF V !ρ FV‰F l~(| Q w d$ |$Q 9Dу9Lj3W #`߉V [e#9i# u݋Q$9+9v;B$s B$R(u.$@ @ D$Lt&HEȀ@ +xL誩LG$@ x@ D󉅤;v\+BV B 9D󉅤c<$L$D$SƅNjHR@ D$$K򉅜Ή$ϗƒ υ@ @u뾋򋵜H ȃ EEc|$PD$$!P+ ? 9wP+H A  9*$藖‹@ .x;r\+AN A щ9D󉅤c$|$D$8Ή$莕ƒυy@ @ Dfuf뗋Ή$ƒυ@ j@Ȁu뼋%Ή$r‹g@ @ Du듋%Ή$œ‹@ @ Du듋%Ή$ υB %ٝ u멋%Ή$胒 υ"B w ݝ! u݅멋Ծ򉅜Ή0@w_υ@ uPD$$PvLP$L$褥PLs$:X%Ή$‹z@  @ Du듋%Ή$H‹=@  @Du듋Ή$謏ƒυ @ ; @ffuf뷀39UB 94$LD$D$-L)1 A4$D‹D$T$`08=8.D$D$ D$tD$ $+<v؋t@>|$t$$R&Љ։+7&<$0v@ t&M$t&$ݝ8Ȱ9݅8ٽ؋ f٭ߝ٭ɃȀوw؋e)?DщA 9O&+AݜHvHv H  o"XXƅуɀE41҉4K@w D$4$@ x tmƅPv4F F$?&ҋ,*u+1x$pfA @y ȿ1ɍvҍ LJЉʃE0u+ɀB҈fpd΋+@ 6D9򋅐 $p$A[AH $;(1ƅRt&ƅ3hD$$D$m@ P|9| L$D$˜L;rN+B7@ 9 Dt$|$$S  ǁ%  Iff ǁ%  ( ǁ%  Mff ǁ%  9 ǁ%  ^ ǁ%  PD$$PRLD$$LPD$$fPZPD$$蕻PzPD$$tPuLD$$=LLD$$LL$LPD$$PPD$$˺PPD$$ZPxƉ+PD$$*PPD$$ PPD$$P&L$/LtL$LPD$$PPD$$ĹP51Ɉ,&4$p11҉4DXt $ƅXk+APD$D$$tD$"<$L$Ƌ4$0<$ɋyX||Bɋy||ɋy1||Jҋ||yɋ||yɋ||ɋy||ɋy||ɋyv||`ɋy||ɋy ||AɉI||3Aɉo||YyɋU||?Aɉ{||eɋy||ɋy||PD$ D$<$PT$D$"$|e‹JpN+9׉+(LLx@ %軏@4|F d+|!B Q9N4ƅA 1VF$ƅ ƅ$@ cƅҁtA +$@ cƅҁ\@  $詒ƅuf@?ljĿ?LD$$近LDž?+ʉ9x+t$$薹1 9; ‰򉕔 Q 9)…tE‰D$$T$蜧ɉuljƅƅیO ƅPD$$mPɋy||Og||QЉ+LҋLx@ <蠋H PdP@ p4pp $LD$"D$L PD$$jP1ƅtA9y;`tL<$D$ T$)D$蛳LXX=PvPwz  tOA9NPvPw9  uu-ƅ 뇃 vt4$LxLƅA$PD$"D$Pf$PD$"D$P$PD$"D$P1ɉp1҉ΉF9;tPL<$D$ pD$)D$肱PL44 t8F9YΉD& uȀu 1҃p $/w1҉Kp<|+؍x$軾D$$袾Gg| |O9||4$JvGу%G|Nj|dBB$14$$r4$LuLGh||B$I pƅGX||MʉL*LpZAZt fIJ $9NjϋVp=ZN$P}Zȉ)ЃZ‰w‹B 9L4$T$T$/vL)ƉXh$貺틅 4h$苺P+p$YH$K.?؋+pL$$ʉLCLpZHEqVt&'UVS@E uEEE̋EEEEEEEEEF v tD$D$4$wt Zfz1t&Kvu⍶荶$t&۸v봍&'U(] vuu}} Tu|$4$蠫]u}]ÍvF tRF @ tID$ D$5|$4$tPt9x g&ظ띐t&G tG @ y뢍vt&t>wt Zfz1t&Kvu⍶荶$t&軷v봍&'U(]Vuu}} Tu]} }uu]t&F tZF @ tQD$ D$4|$4$ծtPtIx w&ظ]u}]fG zG @ m땍t&t>wt 뮐t&z1t&럍u⍶荶$t&苶v봍&'U(]蹻&uu}} Tu]} }uu] t&F tZF @ tQD$ D$4|$4$襭tPtIx w&ظ]u}]fG zG @ m땍t&t>wt 뮐t&z1t&럍u⍶荶$t&[v봍&'UWVS茺} f˗;>|E܉$E<[^_]ÐD$D$$蜛r&D$$ЭE뢉E蓶E؋+9} $苯vUWVS<é,Uh>E䋃0@ 4U @ tdUU܋P;uI@@ t+@E論;>|E$̆E,[^_]ÐD$$ЬEЍ$譮t&UWVS\E`@ PH ɉM@B MB U PtdUU؋P;@@ t1@E &諕;>|E$̅E<[^_]ÐD$$ЫEЍvHM܋J MM9Mt(M+MMMMH E܉B H @ M܉UD$ $菡U؉B $DUWVSQE Džt,#M}( 1҉߭؃tz݃|zz 4$衧AD$$U19OB 9zvfƉ~9vD$$U;tԉB@lj9;9)ЃƋ0t89s+28:09w;vFvv…tPxP‰x9wҋ9;t&D$G$U9;wҋx;s @D$G$U9tщ?9ta9`9K9F9t4$P} t8Ĝ[^_]ËDžuu܉}DžDžsL܃D܉++99D$$U@Dž1ΉIt&D$$U96M<9w~9zωщv9sR)4D$$U9}~9r;։Ot& 9r򉕸9V9 9w򉕸+NDFD$$U9_]Džt&899r򉅼@~9t&ʃ)у8Pꉅ1A+<+029w8J9 9wtS ) 8:9wJrJD$@$U9D${$fUщWVSĬ1D#vw|։XGq1҉`dDٽ^߭`^ f\٭\߽`٭^`wXLDž0DžHDž4fL+H90^H9LDH <@9P<8>P0@f<@9<@T4<P8>4>8P@|TP0넋0<Dž0TM09H0}h9LL+H)9k4 hLl0p<L4#9LH XDD$,$U, P<DžT<<L44k4 hHlLp0MPXDžTUD$$Uȉ$E܍D$+UȄ8BUUD$$M $D$EDg1ɋUȅWtBB"EtUBB\WUT$D$d$躇MD$}L$$蛇ED$D$$|UD$T$$]MD$L$$>ED$D$$|D$$yǃp'l'${ZtD$ D$$dp'tD$$\xEl[^_]ÐEԍ,ML$7 $MĉD$`D$$SMąt@<fEԍUT$ $D$I`D$$S^fUȉMD$"D$$肌MċUȉEt&E$u_$\UҋUȉE MԍfEЉM1M܉$U9_$\M̉L$MD$EԉL$MЉD$L$L$ML$M܉L$ $Ej\MċU&$ EEMĉ$*PMfMĉ$PMt&Mĉ$mnMt&Mĉ$UnMt&B f@tv|CEEЉMEA D${$螂U(]Iö}u 11)u]u}]Í|D$E$ρ&U8]ًF}u 11 )d@ teH 4l'@ U4$D$[UF @tUM4$tMU䋃4]u}]ÉUoU뚍|D$E$UWVSY<0 8)F:E@ @ ED@ HtiD@ @ D$EU܉L$D$D$ $g$$rYU܋E<[^_]Ð>똉UD$$=~U܉8]vUD$D$$mU܉E8fU܉MD$D$$:M؋U܋>D$E$Bv'UE SKø$EED$E$_@ t0RU@ D$l'UT$$i$[]ÍvUT$D$$葇U뿍t&UWVS̈9, 9 )UB tfD@ Rtu@ $D$@`MM܉E0lM܉UttT$$JE䋓,[^_]Í$D$X|‹D@ uUD$D$$菆Uk&{tD${$a넍D$E$}v'UWVS茇, 9  )E@ Pd@ H 4$-U1҅…tJ T$4$MKIF @t4$pE䋓4E,[^_]Ít&U`sD${$FU뗐UpjU܉qD$$z42D$E$4|UWVS<é,0  )N M@ @ E1tD@ @p'UɃ΁EEΉL$$wgMM؉hiM؅Uttt$$GE䋓,[^_]ÍUD$D$$U܉EIfUD$$eyU܃HfqD${$넍9D$E$zUS΄;oUWV M u}Uɉu}EuEϋuUu9v9щ1 v9vL11ɉȋMt؃ڃ ^_]Í&u 1ƋM1lj뾍ЃUuE;uv9s1뛍vuڃES]UU]At&ME +EM UuMUU ׉u։e9։Ur UM9s;ut1t&O1UVS-Út&Ћu[^]US[`0Y["my sub" not yet implementedToo many arguments for %sNot enough arguments for %s$_a SCALARan ARRAYa HASHa CODEConstant is not %s referenceBEGINUNITCHECKToo late to run CHECK blockINITToo late to run INIT blockPrototype mismatch: sub %-p: none vs (%.*s)Can't undef active subroutine__ANON__::__ANON__autouseSubroutine %s redefined$[FIELDSa constant (undef)a constant (%-p)didsnegative pattern binding (!~)a variableoops: oopsHVoops: oopsAVThat use of $[ is unsupportedlocaldo blocknon-lvalue subroutine callCan't modify %s in %sUseless localization of %sDB::postponedSTDOUTFormat %-p redefinedFormat STDOUT redefinedBareword found in conditional() operator construct# comment %04lx %04lx XXXX %04lx XXXX %04lx %04lx %04lx %04lx %04lx FINAL&`'123456789+-@array%hashpanic: ck_splitblock or sub {}one of %.*ssubroutine entryscalar[]%s%c...%c__ANONIO__hash or arraydefined(@array) is deprecateddefined(%%hash) is deprecatedpanic: ck_greprequireopen_INopen_OUT%s[%s:%ld]Runaway prototype%s:%ld-%ldModule name must be constantunimportCORE::GLOBAL::globFile::GlobFile::Glob::csh_globmainattributes.pmattributesourmyCan't declare %s in "%s", @$%* Can't use global %.*s in "%s"Bareword "%-p" not allowed while "strict subs" in useType of arg %d to %s must be %s (not %s)Missing comma after first argument to %s functionAssignment to both a list and a scalarPossible precedence problem on bitwise %c operatorCan't use bareword ("%-p") as %s ref while "strict refs" in usepanic: no address for '%s' in '%s'Constant subroutine %s redefined'%s' trapped by operation mask%-p() called too early to check prototypeStatement unlikely to be reached (Maybe you meant system() when you said exec()?) No such class field "%s" in variable %s of type %sUseless use of %s in void contextUseless use of sort in scalar contextFound = in conditional, should be ==panic: unexpected lvalue entersub args: type/targ %ld:%lupanic: unexpected lvalue entersub entry via type/targ %ld:%luUnexpected constant lvalue entersub entry via type/targ %ld:%luCan't localize lexical variable %spanic: fold_constants JMPENV_PUSH returned %dUsing a hash as a reference is deprecatedUsing an array as a reference is deprecatedDeprecated use of my() in false conditionalValue of %s%s can be "0"; test with defined()Useless use of /d modifier in transliteration operatorReplacement list is longer than search listApplying %s to %s will act on scalar(%s)Use of /g modifier is meaningless in splitMalformed prototype for %s: %-pUseless use of %s with no valuesArray @%-p missing the @ in argument %ld of %s()Hash %%%-p missing the %% in argument %ld of %s()/%.*s/ should probably be written as "%.*s" (Maybe you should just omit the defined()?) %s argument is not a subroutine name%s argument is not a HASH or ARRAY element or a subroutine%s argument is not a HASH or ARRAY element or slicelvalue attribute ignored after the subroutine has been definedVersion number must be a constant numberParentheses missing around "%s" listUse of assignment to $[ is deprecatedCan't use %s for loop variablepanic: allocmy illegal flag bits 0x%lxCan't use global %c^%c%.*s in "%s"`$!T"!!A$!!!!!!!!##!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!#l#L#!$!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!#!!!!!!!!!!!!!!!#!!!!!!!!!!!!!#!!!!!!!!!!!#!!!!!#!"!!!!!!!!!!!!!!!!!`"`"!""!!!!!!!!!!!"""!"""!!!"!!!!!!!!""""!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!q$!""!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!11./. 3.1.2t2t2..04A0...................B4G1.....2.{0 4. 4..... 4 4 4 4 4 4 4 4 4 4 4 4 4. 4 4..................... 4 4 4..................q0{0............2\0N4#1.....5..2N4#1.....\/.....................4B4B4B4.4......P1G1G1.P1P1P1....u1dAdAdAdA;@;@dA;@;@;@ files in place (makes backup if extension supplied)-Idirectory specify @INC/#include directory (several -I's allowed)-l[octal] enable line ending processing, specifies line terminator-[mM][-]module execute "use/no module..." before executing program-n assume "while (<>) { ... }" loop around program-p assume loop like -n but print line also, like sed-s enable rudimentary parsing for switches after programfile-S look for programfile using PATH environment variable-t enable tainting warnings-T enable tainting checks-u dump core after parsing program-U allow unsafe operations-v print version, subversion (includes VERY IMPORTANT perl info)-V[:variable] print configuration summary (or a single Config.pm variable)-w enable many useful warnings (RECOMMENDED)-W enable all warnings-x[directory] strip off text before #!perl line and perhaps cd to directory-X disable all warnings0001-gentoo_MakeMaker-RUNPATH.diff0003-gentoo_cpan_definstalldirs.diff0004-gentoo_cpanplus_definstalldirs.diff0005-gentoo_create-libperl-soname.diff0006-gentoo_MakeMaker-delete_packlist.diff0007-fixes_8d66b3f9_h2hp_fix.diff0008-fixes_f178b03b_h2ph_using_deprecated_goto.diff0011-gentoo_IO-Compress_AutoLoader_dropped_from_Compress-Zlib.diff0012-fixes_84601d63_CGI-3.50.diff split(/,/,q)b]]]]]]]]bb]]b]]]]]]]]]]]]]]]]]]D]]]]]]]]]D]]b]]]]]]]]]]]]]]]]]]]]S]]]d]]]]]]]]]49]]]]]]]]]B]1]]]c"]]J#] ]]dS:utf8:utf8:utf8:utf88888888888888c>888888888888888888c>888888888888=88c>888888888888888888c>c>=c>88=888c>88888=j=c>%=c>c>88888888c>8c>c>*8=8c>c>88c>c>c>8c>88c>c>c>>Apanic: gv name too long (%lu)VERLOADTF8LOCALEARNING_BITSfilehandledirhandleBad symbol for %soverloadingin overloaded package has no overloaded magic left TIEHASH (Did you mean &%s instead?) ::ErrnoTie::Hash::NamedCaptureHad to create %s unexpectedlyXPORTAnyDBM_File::ISANDBM_FileDB_FileGDBM_FileSDBM_FileODBM_FileHILD_ERROR_NATIVENCODINGREMATCHOSTMATCHTF8CACHE$%c is no longer supported%s::_GEN_%ldUNIVERSAL%s::SUPERniloverloadCan't resolveStub found while resolvingDESTROY(${}(@{}(%{}(*{}(&{}(++(--(!(=(abs(neg(<>(int(<(<=(>(>=(==(!=(lt(le(gt(ge(eq(ne(+(+=(-(-=(*(*=(/(/=(%(%=(**(**=(<<(<<=(>>(>>=(&(&=(|(|=(^(^=(~(atan2(cos(sin(exp(log(sqrt(x(x=(.(.=(~~(-X(qr|BBBBlBTBBBBBBBBBBBBBBBBBBBBBBBBB,,,,,,,,,BBBBBBBBBBBBBBBBBBBBBBBćBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB@33333333@3|\@@ l ğLܟ,lğLܟ,lƘƘƘƘƘȥ[. 2ң;;;;EٵE[ AUTOLOAD444444555555Attempt to free unreferenced glob pointersCannot convert a reference to %s to typeglobName "%s::%s" used only once: possible typo, right argument in overloaded package , right argument has no overloaded magicOperation "%s": no method found,%sargument %s%s%s%sCopy method did not return a referencepanic: Can't use %%%c because %-p is not availablepanic: Can't use %%%c because %-p does not support method %sVariable "%c%s" is not importedGlobal symbol "%s%s" requires explicit package nameCan't use anonymous symbol table for method lookupCan't locate package %-p for @%s::ISAUse of inherited AUTOLOAD for non-method %s::%.*s() is deprecatedCan't locate object method "%s" via package "%.*s"Can't locate object method "%s" via package "%.*s" (perhaps you forgot to load "%.*s"?)%s method "%.256s" overloading "%s" in package "%.256s"L<<::???A:????qZ~~~~~t~)~}}S}}||{{<|{{{zzz=zzyyIy&yxKxxwwwlwHw$wwvv)vcEvutu#utstr7r7rrrqqXẢ@ш}YB{W i͌Zq" E46|2҆0o onnVU+SS1UT0oUUQQfQQPPePNPO[b[[WfWWWV\\A\(\y](]]NLLuL$LKJNIIHHHHjHSH 4 - & ?@@ @0@Number too longIdentifier too longPerl_pmflag() is deprecated, and will be removed from the XS APIInteger overflow in decimal number (Might be a runaway multi-line %c%c string starting on line %ld) Lexing code internal error (%s)(possibly a missing "use charnames ...")}} did not return a defined valueWarning: Use of "%.*s" without parentheses is ambiguous%s (...) interpreted as function%s found where operator expected (Missing semicolon on previous line?) (Do you need to predeclare %.*s?) (Missing operator before %.*s?) Can't find string terminator %c%s%c anywhere before EOFpanic: utf16_textfilter called in block mode (for %d characters)panic: utf16_textfilter called after error (status=%ld)filter_del can only delete in reverse order (currently);}continue{print or die qq(-p destination: $!\n);}"%s" not allowed in expressionSearch pattern not terminated or ternary operator parsed as search patternUse of /c modifier is meaningless without /gTransliteration pattern not terminatedTransliteration replacement not terminatedLexing code attempted to stuff non-Latin-1 character into Latin-1 inputAmbiguous use of %c{%s%s} resolved to %c%s%sAmbiguous use of %c{%s} resolved to %c%sNo package name allowed for variable %s in "our"Can't use "my %s" in sort comparisonPossible unintended interpolation of %s in stringBad evalled substitution patternInvalid range "%c-%c" in transliteration operatorAmbiguous range in transliteration operatorPossible unintended interpolation of $\ in regexUnrecognized escape \%c passed throughMissing right brace on \N{} or unescaped left brace after \N.Invalid hexadecimal number in \N{U+...}Malformed UTF-8 returned by \NDeprecated character(s) in \N{...} starting at '%s'Missing control char name in \cpanic: constant overflowed allocated spaceUnrecognized character \x%02X; marked by <-- HERE after %s<-- HERE near column %dMissing right curly or square bracketBEGIN { require 'perl5db.pl' };Unsupported script encoding UTF-32LEUnsupported script encoding UTF-32BEUse of := for an empty attribute list is deprecatedUnterminated attribute parameter in attribute listThe 'unique' attribute may only be applied to 'our' variablesInvalid separator character %c%c%c in attribute listUnmatched right square bracketUse of bare << to mean <<"" is deprecatedDelimiter for here document is too longUse of comma-less variable list is deprecatedMultidimensional syntax %.*s not supportedScalar value %.*s better written as $%.*sCan't use \%c to mean $%c in expressionBad plugin affecting keyword '%s'dump() better written as CORE::dump()Ambiguous call resolved as CORE::%s(), %sBareword "%s" refers to nonexistent packageAmbiguous use of -%s resolved as -&%s()Operator or semicolon missing before %c%sAmbiguous use of %c resolved as operator %cpanic: snprintf buffer overflowPrecedence problem: open %.*s should be open(%.*s)Possible attempt to separate words with commasPossible attempt to put comments in qw() listSubstitution pattern not terminatedSubstitution replacement not terminatedUse of /c modifier is meaningless in s///Prototype after '%c' for %-p : %sIllegal character %sin prototype for %-p : %sIllegal declaration of anonymous subroutineIllegal declaration of subroutine %-p0b11111111111111111111111111111111next token ???within stringwithin patternnext char ^%c\%03oat EOFat end of line at %s line %ld, near "%.*s" %-p%s has too many errors. lex_read_tocharnamesundefConstant(%s) unknown: %s} is not definedConstant(%s): %s%s%sPropagatedCall to &{$^H{panic: scan_numMisplaced _ in numberIllegal octal digit '%c'Illegal binary digit '%c'Integer overflow in %s number%s number > %s non-portableinteger+-0123456789_floatsayelseif should be elsif;&/|})]oaiuwef!=No comma allowed after %s(eval readpipelex_next_chunk;}lex_read_space([{< )]}> )]}>msixopgcmsixopSearch pattern not terminatedlex_peek_unicharlex_read_unicharlex_discard_tolex_unstufflex_stuff_pvnlex_stuff_sv ;[#!%*<>()-=])} =wds]rnftbxcavaA01! zZ79~[\]^_?{...}[...]L\uU\lpanic: yylex:'{$()| \%c better written as $%clLuUEQMissing right brace on \x{}Missing braces on \N{}Missing right brace on \N{}\N{U+%X.%XqqFormat not terminateduse feature ':5.12';LINE: while (<>) {chomp;our @F=split(%s);our @F=split(' ');=cutperl -indirCan't exec %sToo late for "-%.*s" optionpanic: input overflowuniqueUse of :unique is deprecatedlvaluelockedUse of :locked is deprecatedUnterminated attribute listsyntax errorUnmatched right curly bracket+-*/%.^&|<Reversed %c= operator!=~ should be !~Excessively long <> operatorUnterminated <> operatorGlob not terminatedreadline{$:+-Array lengthScalarFinal $ should be \$ or $nameSIGYou need to quote "%s"$@"'`q&*<%Array $#+-'"studyNumberStringBackticksBackslashmsyqqwxrCOREqualify as such or use &Bad name after %s%sBareword%s::DATA:encoding(%-p)CORE::%s is not a keywordMissing $ on loop variable__PACKAGE__No such class %.1000s|&*+-=!?:.<> should be quotesmsixopgcedo subroutine namesort is now a reserved wordMissing name in "my sub"Prototype not terminated$@%*;[]&\_after '_' 0377777777770xffffffffBinaryOctalHexadecimaloctalhexadecimalzDAUnimplementedUse of "do" to call subroutines is deprecatedۙ|J%ƚHUٝƝ\kV2Q֯uc^t_3 מ ңcP;q7+ٿƿzH$۾r=)IQջX+\Ĺ^,spBߵ-Ie!V ױZt`@ޗ+-dC0 r_)W%ʥwJb,ߢ3*̬&ܫvcN;&Э`ٰ=A@JKTKzzzzzzz %LY\aCz -+s0sh]nDDsC!s-4xsDDD;;?2XQnGs7 "st sL6DDs#2Phwr{y139:SZ;YP [Z EHG Q !"#$%&'()*+,-./0123456789:;<=>?@ABCDFIJKLMNORSTUVWXY\j@!"#$%fH() x [6E@AB[F"#$%iZ()Cx9z$%N=?}[B< @A~[[ \ [-d[=>:?BE|G[IJKLMUABC[E=[UVYi=TUVY[\&[[\[EABC[[(hj-nABCABC~[ABC([-Z[ABC?5ABC?ABC ABC56ZABCABCO'C)TUV.Y[NOABCZTUVLZYZZU Z[ZkZ !"#ABC'()*+-./012ABC789:;<>ABC DPZZPQRZZZWXZ[ [ABCZ !"#ABC')56+k-./012Z1789:;<F>)ABCODFTUVYPQRWXZ[ ABC3456+-./012789:;<Z>KLMNODTUVYPQRWXZ[ OABCTUVY3456+-./012Z789:;<>LMNODTUVYPQRWX[ ABC3456+-./012ZABC789:;<>MNODTUVYZPQRWX[ ABCABCABC+-./012Z789:;<Z>ZDPQRWX[ !"#'),3456ABCEFGHIJKLMNOTUVYZ 3456+-./012789:;<>NODTUVYPQR3456WX[ NOTUVY356+-./012789:;<>NODTUVYPQRWX[  !"#')+-./012789:;<>ABCDPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWXZ[ +-./012789:;<>DPQRWX[ !"#'),3456ABCEFGHIJKLMNOTUV,YZ3456FGHIJKLMNO,TUVY3456FGIJKLMNO,TUVY3456GIJKLMNO,TUVY3456IJKLMNOTUVYSrrrrrrr+l:O!?!"#z) r].~tuvw,xy *mnce !g{lm  yA DD N X 1=4 !"#$%`7cZ0r<wCEGKM    WQRT(&!BHJL^^\dYUbse[fg !"#$%&'()*+h,-./0ij01kn23456789:t;<=>?@zABCDEFG{!Hv|}uopSIJKLMN !"#$%'()*+,-./1P:;<=>?@@}iABCDEFGaHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFIGHIJKLMN !"#$%()*+p,-./1:;<=>?@OABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@VABCDEFGHoIJKLMN !"#$%()*+,-./1:;<=>?@pABCDEFqGxbHbIJKLMNbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbk !"#$%'()*+,-./1D:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1D:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMDN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMFN !"#$%'()*+,-./1:;<=>?@ABCDEFGHIJKLMSN !"#$%'()*+,-./1:;<=>?@ABCDEFGEHEIJKLMNEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEPD 56ECCC=  <798:;@QDD" VY?FGG G!ȯ`лƛIJ*W>HIPI5^bI/ZM#1UTSXp|xyuvs~}{zwtd]eK024.3aLiomȩgJONBA_c,,/[rlhnjfR" qk\"" (,"+$%5"'&)  ]^_`abcdeeefffffffgggggggghhhiijjkklllllllmnooppqrstuuvvvvvvwxyyz{|}~]V,+=I82qj> 8QR ~9/2;5d|f'_h3TU-VWXYZ[\6]^_`abs^be=\flmuvwxz{~|||  !"#'()*+-./012789:;<>DPQRWX[_gijy`_[}}[[[[<[[[_[[[__[Z&k !"#')ABCE[,3456FGIJKLMNOTUVY[_e[_``````[``ZZ[[Z?Z_qZ[Z?Zpqrqtgors`arZEZZZZZHZ[Z_Z_ZZZZ[ZrrZZZZZnnccrcpZZcZccd$%hhZkcckkec[cnkrksZZcchAPADNAME = 0x%lx(0x%lx) PAD = 0x%lx(0x%lx) %2d. 0x%lx<%lu> FAKE "%s" flags=0x%lx index=%lu %2d. 0x%lx<%lu> (%lu,%lu) "%s" Variable "%s" is not availableVariable "%s" will not stay sharedpanic: pad_findmy illegal flag bits 0x%lxpanic: pad_add_name illegal flag bits 0x%lx"%s" variable %-p masks earlier declaration in same %s (Did you mean "local" instead of "our"?) %2d. 0x%lx<%lu> panic: pad_free curpadpanic: pad_free popanic: pad_swipe curpadpanic: pad_swipe popanic: pad_alloc%-p never introducedscope"our" variable %-p redeclaredpanic: pregfree comppadpanic: regfree data code '%c'Regexp%s in regex m/%.*s%s/U+alphspacgrapasciblancntralnuloweuppedigiprinpuncxdigitPOSIX class [:%.*s:] unknownEmpty \%c{}Missing right brace on \%c{}%cutf8::%.*s %04lx %04lx AlnumBlankVertSpaceHorizSpaceASCIIInvalid [::] classInvalid [] range "%*.*s"%cutf8::Is%s Unterminated verb patternACCEPTCOMMITPRUNESKIPUnknown verb pattern '%.*s'Sequence (?R) not terminatedIllegal patternExpecting close bracketnopSequence (? incompletedon't ?-Unmatched (Unmatched )Junk on end of regexpUnmatched [Internal urpQuantifier follows nothingReference to invalid group 0Unterminated \g... patternUnterminated \g{...} patternTrailing \Internal disasterCan't do {n,m} with n > mNested quantifierstuE_TRIE_MAXBUFPERL_RE_COLORSPanic opt closeRegexp out of spacemsixregcompSUCCEEDEOSMEOLSEOLNBOUNDNBOUNDLREG_ANYSANYCANYANYOFNALNUMNALNUMLNSPACENSPACELNDIGITNDIGITLCLUMPBRANCHBACKEXACTEXACTFEXACTFLNOTHINGSTARPLUSCURLYCURLYNCURLYMCURLYXWHILEMOPENCLOSEIFMATCHUNLESSMSUSPENDIFTHENLONGJMPBRANCHJMINMODLOGICALRENUMTRIETRIECAHOCORASICKAHOCORASICKCGOSUBGOSTARTNREFNREFFNREFFLNGROUPPINSUBPDEFINEPENDLIKEOPFAILVERBMARKPOINTCUTGROUPKEEPSLNBREAKNVERTWSNHORIZWSFOLDCHAROPTIMIZEDPSEUDOTRIE_nextTRIE_next_failEVAL_ABEVAL_AB_failCURLYX_endCURLYX_end_failWHILEM_A_preWHILEM_A_pre_failWHILEM_A_minWHILEM_A_min_failWHILEM_A_maxWHILEM_A_max_failWHILEM_B_minWHILEM_B_min_failWHILEM_B_maxWHILEM_B_max_failBRANCH_nextBRANCH_next_failCURLYM_ACURLYM_A_failCURLYM_BCURLYM_B_failIFMATCH_AIFMATCH_A_failCURLY_B_min_knownCURLY_B_min_known_failCURLY_B_minCURLY_B_min_failCURLY_B_maxCURLY_B_max_failCOMMIT_nextCOMMIT_next_failMARKPOINT_nextMARKPOINT_next_failSKIP_nextSKIP_next_failCUTGROUP_nextCUTGROUP_next_failKEEPS_nextKEEPS_next_failMULTILINESINGLELINEFOLDEXTENDEDKEEPCOPYUNUSED_BIT_6UNUSED_BIT_7ANCH_BOLANCH_MBOLANCH_SBOLANCH_GPOSGPOS_SEENGPOS_FLOATLOOKBEHIND_SEENEVAL_SEENCANY_SEENNOSCANCHECK_ALLUNUSED_BIT_19MATCH_UTF8USE_INTUIT_NOMLUSE_INTUIT_MLINTUIT_TAILSPLITCOPY_DONETAINTED_SEENSTART_ONLYNULLpanic: reg_node overrun trying to emit %dpanic: Unknown flags %d in named_buff_iterpanic: Unknown flags %d in named_buff_scalarpanic: Unknown flags %d in named_buffSequence (?#... not terminatedpanic: no svname in reg_scan_nameReference to nonexistent named group%s in regex; marked by <-- HERE in m/%.*s <-- HERE %s/panic: bad flag in reg_scan_name\N in a character class must be a named character: \N{...}\N{NAME} must be resolved by the lexerIgnoring zero length \N{} in character class in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Using just the first character returned by \N{} in character class in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Using just the first characters returned by \N{} in regex; marked by <-- HERE in m/%.*s <-- HERE %s/POSIX syntax [%c %c] belongs inside character classes in regex; marked by <-- HERE in m/%.*s <-- HERE %s/POSIX syntax [%c %c] is reserved for future extensionsInvalid escape in the specified encoding in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Unrecognized escape \%c in character class passed through in regex; marked by <-- HERE in m/%.*s <-- HERE %s/False [] range "%*.*s" in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Unterminated verb pattern argumentVerb pattern '%.*s' may not have an argumentVerb pattern '%.*s' has a mandatory argumentSequence %.3s... not terminatedSequence (%.*s...) not recognizedSequence (?%c... not terminatedpanic: reg_scan_name returned NULLpanic: paren_name hash element allocation failedSequence (?%c...) not implementedReference to nonexistent groupSequence (?{...}) not terminated or not {}-balancedEval-group not allowed at runtime, use re 'eval'Eval-group in insecure regular expressionSequence (?(%c... not terminatedSwitch condition not recognized(?(DEFINE)....) does not allow branchesSwitch (?(condition)... contains too many branchesUnknown switch condition (?(%.2sUseless (%s%c) - %suse /%c modifier in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Useless (%sc) - %suse /gc modifier in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Useless use of (?-p) in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Sequence %.2s... not terminatedReference to nonexistent or unclosed groupUse of octal value above 377 is deprecated in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Unrecognized escape \%c passed through in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Quantifier in {,} bigger than %d%.*s matches null string many times in regex; marked by <-- HERE in m/%.*s <-- HERE %s/error creating/fetching widecharmap entry for 0x%lXpanic! In trie construction, no char mapping for %ldQuantifier unexpected on zero-length expression in regex; marked by <-- HERE in m/%.*s <-- HERE %s/Variable length lookbehind not implementedLookbehind longer than %lu not implemented in regex m/%.*s%s/lTDll_!_!_!_!_!_!_!_!_!_!NNNNNNNNNNU!NNNK!NNNNN!N!NN!NNd"O NNNNNNNNN t Nj NNNNNY N!N !! N JF'&%& &D&5%%%%$$#j$#$#0$H#$#M$e#$#$+##""" "3'a&&R%L;;:::d99(98IuuuK Lu%5lu %s %cx{%lx}%c%03o%c%o\0%*s%s = 0x%lx "%s" :: " "%s" { GV_NAME = %s-> %sWILDSV_UNDEFSV_NOSV_YESSV_PLACEHOLDER<%lu%s>CV(%s)(null)[%s] [UTF8 "%s"](%g)(%ld) [tainted](NULL)[%lu]NULL OP IN RUN%-4lu %*sTYPE = %s ===> (%lu) DONE (was %s) LINE = %lu PACKAGE = "%s" LABEL = "%s" TARG = %ld ,VOID,SCALAR,LIST,UNKNOWN,KIDS,PARENS,STACKED,REF,MOD,SPECIAL,LATEFREE,LATEFREED,ATTACHED,TARGET_MY,REFCOUNTED,COMMON,BACKWARDS,SQUASH,DELETE,COMPLEMENT,IDENTICAL,GROWS,DOLIST,AMPER,DB,HASTARG,NOPAREN,INARGS,NOMOD,SV,AV,HV,MAYBE_LVSUB,LVAL_DEFER,STRICT_REFS,OUR_INTRO,BARE,STRICT,ARYBASE,WARNING,ENTERED,LINENUM,INTRO,EARLY_CV,GUESSED,SLICE,EXISTS_SUB,NUMERIC,INTEGER,REVERSE,IN_RAW,IN_CRLF,OUT_RAW,OUT_CRLF,EXIT_VMSISH,HUSH_VMSISH,FT_ACCESS,FT_STACKEDPRIVATE = (%s) GV = %s GV = NULL SV = %s REDO ===> NEXT ===> LAST ===> OTHER ===> REFCNT = %lu {} (RUNTIME)PMf_PRE %c%s%c%s PMf_PRE (RUNTIME) PMf_REPL = ,ONCE:USED,TAINTED,SCANFIRST,ALL,SKIPWHITE,CONST,KEEP,GLOBAL,CONTINUE,RETAINT,EVALPMFLAGS = (%s) FORMAT %s = SUB %s = (xsub 0x%lx %d) SV = 0 PADSTALE,PADTMP,PADMY,TEMP,OBJECT,GMG,SMG,RMG,ROK,WEAKREF,OOK,FAKE,READONLY,BREAK,OVERLOAD,pIOK,pNOK,pPOK,PCS_IMPORTED,SCREAM,ANON,UNIQUE,CLONE,CLONED,CONST,NODEBUG,COMPILED,LVALUE,METHOD,WEAKOUTSIDE,SHAREKEYS,LAZYDEL,HASKFLAGS,REHASH,CLONEABLE,INTRO,MULTI,ASSUMECV,IN_PAD,IMPORTALL, SV AV HV CV ),TAIL,VALID,EVALED,IsUV,TYPED,OUR,STATE,SV = %s%s UNKNOWN(0x%lx) %s UV = %lu IV = %ld COP_LOW = %lu COP_HIGH = %lu NV = %.*g RV = 0x%lx OFFSET = %lu PV = 0x%lx ( %s . ) CUR = %ld LEN = %ld PV = 0 OURSTASH STASH ARRAY = 0x%lx (offset=%ld) ALLOC = 0x%lx FILL = %ld MAX = %ld ARYLEN = 0x%lx ,REAL,REIFY FLAGS = (%s) Elt No. %ld (%d%s:%d hash quality = %.1f%% KEYS = %ld RITER = %ld EITER = 0x%lx PMROOT = 0x%lx NAME = "%s" BACKREFS = 0x%lx MRO_WHICH = "%.*s" (0x%lx) CACHE_GEN = 0x%lx PKG_GEN = 0x%lx MRO_LINEAR_ALL = 0x%lx MRO_LINEAR_CURRENT = 0x%lx MRO_NEXTMETHOD = 0x%lx ISA = 0x%lx Elt %s [UTF8 "%s"] [REHASH] HASH = 0x%lx PROTOTYPE = "%.*s" COMP_STASH START = 0x%lx ===> %ld ROOT = 0x%lx XSUB = 0x%lx XSUBANY = 0x%lx (CONST SV) XSUBANY = %ld GVGV::GV DEPTH = %ld OUTSIDE_SEQ = %lu LINES = %ld PADLIST = 0x%lx ANONMAINUNIQUEUNDEFINED OUTSIDE = 0x%lx (%s) TYPE = %c TARGOFF = %ld TARGLEN = %ld TARG = 0x%lx FLAGS = %u RARE = %u PREVIOUS = %lu USEFUL = %ld NAMELEN = %ld GvSTASH GP = 0x%lx SV = 0x%lx REFCNT = %ld IO = 0x%lx FORM = 0x%lx AV = 0x%lx HV = 0x%lx CV = 0x%lx CVGEN = 0x%lx LINE = %ld FILE = "%s" FLAGS = 0x%lx EGV IFP = 0x%lx OFP = 0x%lx DIRP = 0x%lx PAGE = %ld PAGE_LEN = %ld LINES_LEFT = %ld TOP_NAME = "%s" TOP_GV TOP_GV = 0x%lx FMT_NAME = "%s" FMT_GV FMT_GV = 0x%lx BOTTOM_NAME = "%s" BOTTOM_GV BOTTOM_GV = 0x%lx TYPE = '%c' TYPE = '\%o' MAGIC = 0x%lx envenvelemsigsigelempackelemmglobnkeystaintsubstrposbmfmuvardefelemcollxfrmamagicamagicelemarylen_phintselem MG_VIRTUAL = &PL_vtbl_%s MG_VIRTUAL = 0 MG_PRIVATE = %d MG_TYPE = PERL_MAGIC_%s MG_TYPE = UNKNOWN(\%o) MG_FLAGS = 0x%02X TAINTEDDIR REFCOUNTED GSKIP MINMATCH MG_OBJ = 0x%lx PAT = %s MG_LEN = %ld MG_PTR = 0x%lx => HEf_SVKEY ???? - please notify IZ %2ld: %lu -> %lu MG_VIRTUAL = 0x%lx BINDPVPVIVPVNVPVMGREGEXPPVGVPVLVPVAVPVHVPVCVPVFMPVIOsv(\0)arylen(#)rhash(%)pos(.)symtab(:)backref(<)arylen_p(@)overload(A)bm(B)regdata(D)env(E)hints(H)isa(I)dbfile(L)shared(N)tied(P)sig(S)uvar(U)overload_elem(a)overload_table(c)regdatum(d)envelem(e)fm(f)regex_global(g)hintselem(h)isaelem(i)nkeys(k)dbline(l)shared_scalar(n)collxfrm(o)tiedelem(p)tiedscalar(q)qr(r)sigelem(s)taint(t)uvar_elem(u)vec(v)vstring(V)utf8(w)substr(x)defelem(y)ext(~)WATCHING, %lx is currently %lx WARNING: %lx changed from %lx to %lx (0x%lx) at 0x%lx %*s REFCNT = %ld %*s FLAGS = (FDF?Buuuuuuuu|utulutdu\uTuLuDu %s %ld during global destructionclosedunopenedsocket%s%s on %s %s %s%s%s on %s %sPERL_HASH_SEEDInvalid version objectv%ld.%ldwidth%d.%0*d_%d%0*doriginalInteger overflow in versionv.Infvinf%.9f, '.' not in PATH on PATHexecuteCan't %s %s%s%sEXECInsecure %s%sCan't fork: %spanic: kid popen errno readSignal SIG%s received, but no signal handler set. SIG%s handler "%s" not defined. Maximal count of pending signals (%lu) exceededAttempt to set length of freed arrayFETCHSIZE returned a negative valuesignoCHLDCLDCLEARSTOREEXISTSFETCHFIRSTKEYNEXTKEYFETCHSIZE__DIE____WARN__No such hook: %sNo such signal: SIG%sIGNOREDEFAULTopen<open>UUUUUUUUUUUUwarnings::Bitspanic: magic_len: %ldSize magic not implementedassigning to $^Od !d &&|&l&d \&<&d d d t ''!d d L'%t%d d d d d d d d d d $d d d # B!"$d !d ,'|"d d d d |!\$$<$d d d d d d d d d d d d d d d d d d d d d d d d d d d $#d #d d d d d d d d d d d d d d d d d d d d d d d d d d d d D"d ",-~,<-~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,,z-~,~,~,-~,~,~,~,~,---------~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,~,X-999::n==9O==99999;>999O:k;9A999999999:999=9H:n:d>999AVAA&B B B B B B B B B BB9=hC1CC999999999999999999999999999 @C9@9:999999999999999999999999999B9 ;panic: hv_store() failed in set_mro_private_data() for '%.*s' %dCan't linearize anonymous symbol tableRecursive inheritance detected in package '%s'Can't call mro_method_changed_in() on anonymous symbol tableCan't call mro_isa_changed_in() on anonymous symbol tablepanic: hv_store() failed in mro_register() for '%.*s' %dInvalid mro name: '%-p'classnameNo such class: '%-p'!panic: invalid MRO!mro::method_changed_indfsmro.c (utf8)panic: hv_placeholders_setpanic: hv_placeholders_ppanic: hv name too long (%lu)%ld/%lddeletestorefetchAttempt to free non-existent shared string '%s'%spanic: refcounted_he_value bad flags %xpanic: hfreeentries failed to free hash - something is repeatedly re-creating entriesAttempt to delete readonly key '%-p' from a restricted hashAttempt to delete disallowed key '%-p' from a restricted hashAttempt to access disallowed key '%-p' in a restricted hashCannot modify shared string table in hv_%sNEGATIVE_INDICESPOPEXTENDUNSHIFTSTORESIZEPUSHOut of memory during array extendCan't call method "%-p" on an undefined valuewithout a package or object referenceCan't call method "%s" on unblessed referenceDeep recursion on anonymous subroutineDeep recursion on subroutine "%-p"Can't use string ("%.32s"%s) as a subroutine ref while "strict refs" in useOverloaded dereference did not return a referenceUndefined subroutine &%-p calledCan't modify non-lvalue subroutine callCan't return %s from lvalue subroutine%s returned from lvalue subroutine in scalar contextCan't return a %s from lvalue subroutineUse of freed value in iterationglob failed (can't start child: %s)glob failed (child exited with status %d%s)utf8 "\x%02X" does not map to Unicodepanic: pp_match start/end pointersReference found where even-sized list expectedOdd number of elements in hash assignmentCan't return %s to lvalue scalar contextUse of reference "%-p" as array indexon an undefined valueCan't call method "%-p" %sNot a CODE referencea subroutineUndefined subroutine calledDB::lsubNo DB::sub routine defineda temporarya readonly valueEmpty arraypanic: pp_iterREADLINE, core dumped$&*(){}[]'";\|?<>~`panic: pp_matchNot %s referencepanic: pp_substSubstitution loopOut of memory during array extenda HASHan ARRAYsv_vcatpvfn()Missing argument in %ssv_vcatpvfnVSTRINGLVALUEGLOBFORMATpanic: del_backrefBad filehandle: %sBad filehandle: %-ppanic: frexp"%\%03loend of string{%s}[%ld]within $.${$/} in NULLREFBizarre copy of %s in %sBizarre copy of %sCannot copy to %s in %sCannot copy to %sSubroutine %s::%s redefinedCan't upgrade %s (%lu) to %luIO::File::Can't weaken a nonreferenceReference is already weakNot a subroutine referencepanic: sv_insertArgument "%s" isn't numericWide character in %sWide charactercat_decodeWide character in $/Integer overflow in format string for %sinternal %%p might conflict with future printf extensionsvector argument not supported with alpha versionsInvalid conversion in %sprintf: panic: attempt to copy value %-p to a freed scalar %ppanic: attempt to copy freed scalar %p to %pConstant subroutine %s::%s redefinedUndefined value assigned to typeglobsemi-panic: attempt to dup freed stringsv_upgrade from type %d down to type %dpanic: sv_upgrade to unknown type %luDESTROY created new reference to dead object '%s'Attempt to free unreferenced scalar: SV 0x%lxpanic: magic_killbackrefs (flags=%lx)panic: utf8_mg_pos_cache_update cache %lu real %lu for %-ppanic: sv_pos_b2u: bad byte offsetpanic: sv_pos_b2u cache %lu real %lu for %-ppanic: sv_pos_u2b_cache cache %lu real %lu for %-ppanic: sv_len_utf8 cache %lu real %lu for %-pDon't know how to handle magic of type \%oUnable to create sub named "%-p"Can't bless non-reference valuepanic: reference miscount on nsv in sv_replace() (%lu != 1)Can't coerce %s to number in %sCan't coerce %s to integer in %sCan't coerce readonly %s to string in %sCan't coerce readonly %s to stringCan't coerce %s to string in %spanic: sv_chop ptr=%p, start=%p, end=%ppanic: sv_chop ptr=%p (was %p), start=%p, end=%pCan't modify non-existent substringpanic: sv_setpvn called with negative strlenArgument "%s" isn't numeric in %sInvalid argument to sv_cat_decodeLost precision when decrementing %f by 1Lost precision when incrementing %f by 1|lL <<ԒK7qjq7#KQ111122111d21|2|2|2|2|2|444|4l54444 54 5 5 5 5 5 1 "Cdh ehFGXXh Y,,Z{|88} 88>HHx(null)"A?OZpanic: unimplemented op %s (#%d) calledsplice() offset past end of arrayOdd number of elements in anonymous hashpanic: avhv_delete no longer supportedAttempt to use reference as lvalue in substrUse of *glob{FILEHANDLE} is deprecatedAttempt to bless into a referenceExplicit blessing to '' (assuming package main)Can't find an opnumber for "%s"Can't return array to lvalue scalar contextCan't return hash to lvalue scalar contextConstant subroutine %s undefinedpanic: pp_splitSplit loopSPLICENot a HASH referencesprintfsubstr outside of stringIllegal modulus zeroIllegal division by zeroCan't take %s of %gdo_study: out of memoryILEHANDLEAMEACKAGECORE::_;$\[@%]CORE::backtick?$@@%&*$Not a SCALAR reference(anonymous)Not a GLOB referencea symbolLIIIDIIIILIII̅ܝ|TOut of memory during string extendOut of memory during list extendCan't use string ("%-32p"%s) as %s ref while "strict refs" in useApanic: corrupt saved stack indexpanic: leave_scope inconsistencypanic: leave_scope pad codeԲ\$$$dd$d$l$ԭDĬtL,d,D$Ĩ<ԧt\<TUUApanic: bad gimme: %d Unknown error Compilation error_<(eval %lu)[%s:%ld]_<(eval %lu)v%d.%d.0featureNull filename used/loader/0x%lx/%s%s: %s.ph (did you run h2ph?).h (change .h to .ph maybe?)Can't locate %s_<(%.10seval %lu)[%s:%ld]_<(%.10s_eval %lu)Exiting %s via %sNo DB::DB routine defined(unknown)(eval)Goto undefined subroutineDB::gotopanic: gotoCan't find label %sLabel not found for "redo %s"Label not found for "next %s"Label not found for "last %s"panic: lastpanic: returnpanic: die E0Null picture in formlineNot enough format arguments%0*.*f%#0*.*f%*.*f%#*.*fpseudo-blockformatsubstitutionSmart matching a non-overloaded object breaks encapsulation%-p did not return a true value%sCompilation failed in require%sCompilation failed in regexpPerls since %-p too modern--this is %-p, stoppedPerl %-p required--this is only %-p, stoppedPerl %-p required (did you mean %-p?)--this is only %-p, stoppedAttempt to reload %s aborted. Compilation failed in require%s in @INC%s%s (@INC contains:Range iterator outside integer rangeCan't use when() outside a topicalizerCan't "break" outside a given blockCan't "break" in a loop topicalizerCan't "continue" outside a when blockGoto undefined subroutine &%-pCan't goto subroutine from an eval-stringCan't goto subroutine from an eval-blockCan't goto subroutine from a sort sub (or similar callback)Can't "goto" out of a pseudo blockCan't "goto" into the middle of a foreach loopUse of "goto" to jump into a construct is deprecatedCan't goto subroutine outside a subroutineCan't "redo" outside a loop blockCan't "next" outside a loop blockCan't "last" outside a loop blockCan't return outside a subroutineRepeated format line will never terminate (~~ and @#)Overloaded qr did not return a REGEXPXXXXWWWtW,_{__{_{_{_{_{__,__^LtLtLtLts tts|L Ԡ,̟(,ܣl$ܨѨƨgoto must have labelTarget of goto is too deeply nested (in cleanup) A~R8 @%C @AToo many args to syscallToo few args to syscallUTCgmtimelocaltime%s(%.0f) too large%s(%.0f) too small%s(%.0f) failed%s %s %2d %02d:%02d:%02d %.0fsetprioritysetpgrpsystemrmdirmkdirrenamechrootHOMELOGDIRchdirlstat() on filehandle %sconnectbindsocketpairtruncateFILENOSEEKTELLWRITENegative lengthOffset outside stringREADPRINTF%s_TOPtopbad top format referenceUndefined top format calledpage overflowUndefined format "%s" calledNot a format referenceGETCNon-string passed as bitmaskAnyDBM_FileAnyDBM_File.pmNo dbm on this machineUNTIETIEARRAYTIEHANDLETIESCALARBINMODEumaskPROPAGATE ...propagatedDied ...caughtWarning: something's wrong``rbJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat!/@s.-T----$.D.d.. ..0 but truemn;Zx0N<[y1OOozScbfdpugkesMACRWXrwx@@closedir() attempted on invalid dirhandle %srewinddir() attempted on invalid dirhandle %sseekdir() attempted on invalid dirhandle %stelldir() attempted on invalid dirhandle %sreaddir() attempted on invalid dirhandle %sOpening filehandle %s also as a directoryUse of chdir('') or chdir(undef) as chdir() is deprecated-T and -B not implemented on filehandlesThe stat preceding lstat() wasn't an lstatPossible memory corruption: %s overflowed 3rd argumentOpening dirhandle %s also as a fileUndefined top format "%s" calleduntie attempted while %lu inner references still existCan't locate object method "%s" via package "%-p"Self-ties of arrays and hashes are not supportedpBA@@XF@HDG$tI85.OWn8ѰSnCIllegal number of bits in vecNONEpanic: do_trans_count line %dpanic: do_vop called for op %u (%s)Negative offset to vec in lvalue contextpanic: do_trans_simple_utf8 line %dpanic: do_trans_simple line %dpanic: do_trans_complex_utf8 line %dpanic: do_trans_complex line %dArg too short for msgsndCan't exec "%s": %s$&*(){}[]'";\|?<>~` -cUse of -l on filehandle %slstatWide character in printUnrecognized signal name "%s"sysopenUnknown open() mode '%.*s'Missing command in piped openCan't open bidirectional pipeecho ARGVOUTinplace openCan't open %s: %sBad arg length for %s, is %lu, should be %ldCan't kill a non-numeric process IDWarning: unable to close filehandle %s properly. panic: sysopen with multiple argsMore than one argument to '%c&' openMore than one argument to '>%c' openMore than one argument to '<%c' openFilehandle STD%s reopened as %s only for inputFilehandle STDIN reopened as %s only for output|tr -s ' ' '\012\012\012\012'|Can't do inplace edit: %s is not a regular fileCan't rename %s to %-p: %s, skipping fileCan't remove %s: %s, skipping fileCan't do inplace edit on %s: %s+}&&'(}&}&}&}&}&}&}&}&}&}&}&}&}&}&}&}&}&)The stat preceding -l _ wasn't an lstatUUUÀInfinite recursion in regexREGMARK%s limit (%d) exceeded%lx %d regexp memory corruptioncorrupted regexp pointersREGERRORpanic: unknown regstclass %dNULL regexp parametercorrupted regexp programMalformed UTF-8 character (fatal)panic: paren_elems_to_push < 0Pattern subroutine nesting without pos change exceeded limit in regexEVAL without pos change exceeded limit in regexComplex regular subexpression recursionkm4fti\lkjlj Internals::HvREHASH $hashrefUsage: %s::%s(%s)Usage: %s(%s)Usage: CODE(0x%lx)(%s)$lastkey$key, $flags$key, $value, $flagsmsixpname[, all ][all]filehandle[,args]inputoutputdetails%-p(%-p)sv, failok=0class, versionv%sobject-ref, methodUNIVERSAL::isaUNIVERSAL::canUNIVERSAL::DOESUNIVERSAL::VERSIONversion::()version::newversion::parseversion::(""version::stringifyversion::(0+version::numifyversion::normalversion::(cmpversion::(<=>version::vcmpversion::(boolversion::booleanversion::(nomethodversion::noopversion::is_alphaversion::qvversion::declareversion::is_qvutf8::is_utf8utf8::validutf8::encodeutf8::decodeutf8::upgradeutf8::downgradeutf8::native_to_unicodeutf8::unicode_to_native\[$%@];$Internals::SvREADONLYInternals::SvREFCNT\%*;@PerlIO::get_layersRegexp::Internals::hash_seedInternals::rehash_seedInternals::HvREHASHre::is_regexp;$$re::regnamere::regnamesre::regnames_countre::regexp_patternUsage: invocant->DOES(kind)lobjlobj is not of type versionlobj, ...reference, kindNULL array element in re::regnames()get_layers: unknown argument '%s'Internals::hv_clear_placeholdersTie::Hash::NamedCapture::FETCHTie::Hash::NamedCapture::STORETie::Hash::NamedCapture::DELETETie::Hash::NamedCapture::CLEARTie::Hash::NamedCapture::EXISTSTie::Hash::NamedCapture::FIRSTKEYTie::Hash::NamedCapture::NEXTKEYTie::Hash::NamedCapture::SCALARTie::Hash::NamedCapture::flagsoperation not supported with version objectCannot find version of an unblessed reference%s does not define $%s::VERSION--version check failed%s defines neither package nor VERSION--version check failed%s version %-p required--this is only version %-puniversal.c Use of uninitialized value%s%s%sSemicolon seems to be missingUnquoted string "%s" may clash with future reserved wordUnsuccessful %s on filename containing newlineCan't use %s ref as %s refCan't use string ("%.32s") as %s ref while "strict refs" in useCan't use string ("%-32p") as %s ref while "strict refs" in useCan't use an undefined value as %s referenceModification of non-creatable array value attempted, subscript %dModification of non-creatable hash value attempted, subscript "%-p"Modification of a read-only value attemptedOut of memory! Insecure dependency in %s%sUnsupported socket function "%s" calledUnsupported directory function "%s" calledThe %s function is unimplemented"%s" variable %s can't be in a packageCan't localize through a referencepanic: memory wrap`!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_  !"#$%&'()*+,-./0123456789:;<=>?  !"#$%&'()*+,-./0123456789:;<=>?@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~T(3>IU`kvͮü¢кƳ֦̠󬡾˽ūğ  !"#$%&')*+,-./012456789:;<=?@ABCDEFGHJKLMNOPQRSVWXYZ[\]^_abcdefghijlmnopqrstuwxyz{|}~ USE_LARGE_FILES USE_PERLIO6 D D @$D@@@@ DD@ 6B"6(6( ""&@  T*T0D V6 W76666d"T"d"T"l"\#l"\#%.%%.%%>%% D.%%.%%%)%%6$$6$$6$$6$$6$$6$$>$$$$$$$$$$$$."#"")77 7677777777 ("(")")"((77)66666Hldhvvv66H( ((" (HDHHh2ivviA HAHAH&"$@@IB6H]H6@@AHDDDDDD6@ @@R 6UB"("  .T""." "( " ""."," ""7I7III)))6)7 ))])]I7)))"6667("("("("(("("(""(("("6@" @6"@6(6(6(((66666666 (10123456789abcdef0123456789ABCDEF\.^$@dDwWsSbB+*?|()-nrtfeaxc0123456789[{]}ZEROHUPQUITTRAPABRTBUSFPEKILLUSR1SEGVUSR2PIPESTKFLTCONTSTOPTSTPTTINTTOUURGXCPUXFSZVTALRMPROFWINCHPWRSYSNUM32NUM33RTMINNUM35NUM36NUM37NUM38NUM39NUM40NUM41NUM42NUM43NUM44NUM45NUM46NUM47NUM48NUM49NUM50NUM51NUM52NUM53NUM54NUM55NUM56NUM57NUM58NUM59NUM60NUM61NUM62NUM63RTMAXIOTPOLLUNUSEDstubpushmarkwantarrayconstgvsvpadsvpadavpadhvpadanypushrerv2gvrv2svav2arylenrv2cvanoncodesrefgenblessrcatlineregcmayberegcresetsubstconttranssassignaassignschopschompi_preinci_predeci_postinci_postdecpowi_multiplyi_dividei_modulorepeati_addi_subtractconcatleft_shiftright_shifti_lti_gti_lei_gei_eqi_nei_ncmpsltsgtslesgesnescmpbit_andbit_xorbit_ori_negatenotcomplementsmartmatchsrandhexoctrindexcryptucfirstlcfirstuclcquotemetarv2avaelemfastaelemasliceaeachakeysavaluesexistsrv2hvhelemhsliceboolkeysjoinlsliceanonlistanonhashsplicepushpopunshiftreversegrepstartgrepwhilemapwhilerangeflipdorcond_exprandassigndorassignentersubleavesubleavesublvcallerwarndielineseqnextstatedbstateunstackenterleaveenteriterenterloopleaveloopredodumpmethod_namedentergivenleavegivenenterwhenleavewhenbreakcontinuepipe_opfilenobinmodeuntietieddbmopendbmclosesselectgetcenterwriteleavewriteprtfsysseeksysreadsyswriteeoftellfcntlioctlflocksendrecvsockpairlistenacceptshutdowngsockoptssockoptgetsocknamegetpeernameftrreadftrwriteftrexecftereadftewritefteexecftisftsizeftmtimeftatimeftctimeftrownedfteownedftzeroftsockftchrftblkftfileftdirftpipeftsuidftsgidftsvtxftlinkftttyfttextftbinarychownunlinkchmodutimesymlinkreadlinkopen_dirreaddirtelldirseekdirrewinddirclosedirforkwaitwaitpidkillgetppidgetpgrpgetprioritytmsalarmsleepshmgetshmctlshmreadshmwritemsggetmsgctlmsgrcvsemopsemgetsemctldofilehintsevalenterevalleaveevalentertryleavetryghbynameghbyaddrghostentgnbynamegnbyaddrgnetentgpbynamegpbynumbergprotoentgsbynamegsbyportgserventshostentsnetentsprotoentsserventehostentenetenteprotoenteserventgpwnamgpwuidgpwentspwentepwentggrnamggrgidggrentsgrentegrentgetloginoncecustomnull operationconstant itemscalar variableglob valueglob elemprivate variableprivate arrayprivate hashprivate valuepush regexpref-to-glob castscalar dereferencearray lengthsubroutine dereferenceanonymous subroutinesubroutine prototypereference constructorsingle ref constructorreference-type operatorquoted execution (``, qx)append I/O operatorregexp internal guardregexp internal resetregexp compilationpattern match (m//)pattern quote (qr//)substitution (s///)substitution iteratortransliteration (tr///)scalar assignmentlist assignmentscalar chopscalar chompdefined operatorundef operatormatch positioninteger preincrement (++)integer predecrement (--)integer postincrement (++)integer postdecrement (--)exponentiation (**)integer multiplication (*)integer division (/)integer modulus (%)repeat (x)integer addition (+)integer subtraction (-)concatenation (.) or stringleft bitshift (<<)right bitshift (>>)numeric lt (<)integer lt (<)numeric gt (>)integer gt (>)numeric le (<=)integer le (<=)numeric ge (>=)integer ge (>=)numeric eq (==)integer eq (==)numeric ne (!=)integer ne (!=)numeric comparison (<=>)integer comparison (<=>)string ltstring gtstring lestring gestring eqstring nestring comparison (cmp)bitwise and (&)bitwise xor (^)bitwise or (|)integer negation (-)1's complement (~)smart matcharray dereferenceconstant array elementarray sliceeach on arraykeys on arrayvalues on arrayhash dereferencehash elementhash slicejoin or stringlist sliceanonymous list ([])anonymous hash ({})grep iteratormap iteratorflipfloprange (or flip)range (or flop)logical and (&&)logical or (||)logical xordefined or (//)conditional expressionlogical and assignment (&&=)logical or assignment (||=)defined or assignment (//=)method lookupsubroutine exitlvalue subroutine returnsymbol resetline sequencedebug next statementiteration finalizerblock entryblock exitforeach loop entryforeach loop iteratorloop exitmethod with known namegiven()leave given blockwhen()leave when blockselect system callwrite exitgetsockoptsetsockopt-R-W-r-w-x-s-M-A-C-O-o-z-S-b-f-d-u-g-k-l-t-T-Bopendirtimesdo "file"eval hintseval "string"eval "string" exiteval {block}eval {block} exitgethostbynamegethostbyaddrgethostentgetnetbynamegetnetbyaddrgetnetentgetprotobynamegetprotobynumbergetprotoentgetservbynamegetservbyportgetserventsethostentsetnetentsetprotoentsetserventendhostentendnetentendprotoentendserventgetpwnamgetpwuidgetpwentsetpwentendpwentgetgrnamgetgrgidgetgrentsetgrentendgrentunknown custom operator/bin/shDon't know how to get file namepanic: vsnprintf buffer overflowrefcnt_dec: fd %d >= refcnt_size %d panic: PerlIO layer array corruptRecursive call to Perl_load_module in PerlIO_find_layerInvalid separator character %c%c%c in PerlIO layer specification %sArgument list not closed for PerlIO layer "%.*s"Usage class->find(name[,load])Layer does not match this perlPerlIOBase_dup %s f=%p o=%p param=%p More than one argument to open(,':%s')openn(%s,'%s','%s',%d,%x,%o,%p,%d,%p) More fds - old=%d, need %d, new=%d PerlIO_binmode f=%p %s %c %x %s perlio.cPerlIO::Layer::findPerlIO::Layer::NoWarningsPerlIO::LayerPERLIO_DEBUG(none)%s:%ld refcnt_dec: fd %d: %d <= 0 refcnt_dec: fd %d refcnt=%d refcnt_dec: fd %d < 0 Cannot flush f=%p Layer %ld is %s define %s %p warning:%s %.*s => %p PerlIOCannot find %.*s Unknown PerlIO layer "%.*s"Pushing %s PERLIOPerlIO_pop f=%p %s :raw f=%p :%s (Null)PerlIO_push f=%p %s %s %p TMPDIRw+IrIwUnknown PerlIO layer "scalar"HashCodeZeroing %p, %d refcnt_inc: fd %d: %d <= 0 refcnt_inc: fd %d refcnt=%d refcnt_inc: fd %d < 0 r+Cleanup layers Destruct popping %s fdupopen f=%p param=%p bytesunixstdioperliopendingcrlfmmap<>0 but trueInteger overflow in octal numberIllegal octal digit '%c' ignoredOctal number > 037777777777 non-portableInteger overflow in binary numberIllegal binary digit '%c' ignoredBinary number > 0b11111111111111111111111111111111 non-portableInteger overflow in hexadecimal numberIllegal hexadecimal digit '%c' ignoredHexadecimal number > 0xffffffff non-portableOAApanic: mapstartNOT IMPL LINE %d:rawCan't fix broken locale name "%s"perl: warning: Setting locale failed. perl: warning: Please check that your locale settings: are supported and installed on your system. perl: warning: Falling back to the standard locale ("C"). perl: warning: Failed to fall back to the standard locale ("C"). POSIXabstrxfrm() gets absurdLANGUAGELC_ALLPERL_BADLANGunset LANGUAGE = %c%s%c, LC_ALL = %c%s%c, LC_LC_ALL= %.*s = "%s", LANG = %c%s%c UTF-8PERL_UNICODENo group ending character '%c' found in templateCharacter(s) in '%c' format wrapped in %sMalformed UTF-8 string in '%c' format in unpackCharacter in '%c' format wrapped in unpack()-group starts with a count in %sToo deeply nested ()-groups in %s'%c' allowed only after types %s in %sCan't use both '<' and '>' after type '%c' in %sCan't use '%c' in a group with different byte-order in %sDuplicate modifier '%c' after '%c' in %spack/unpack repeat count overflow'/' does not take a repeat count in %sWithin []-length '*' not allowed in %sWithin []-length '%c' not allowed in %spanic: marks beyond string end'@' outside of string in unpack'@' outside of string with malformed UTF-8 in unpackMalformed UTF-8 string in unpack'X' outside of string in unpack'x' outside of string in unpack'/' must follow a numeric type in unpackUnterminated compressed integer in unpack'P' must have an explicit size in unpackCount after length/code in unpacklength/code after end of string in unpackCode missing after '/' in unpackCode missing after '/' in packMalformed UTF-8 string in pack'%c' outside of string in packpanic: predicted utf8 length not availableCharacter in 'c' format wrapped in packCharacter in 'C' format wrapped in packCharacter in 'W' format wrapped in packCannot compress negative numbers in packCannot compress integer in packAttempt to pack pointer to temporary valueField too wide in 'u' format in packpanic: string is shorter than advertisedCan only compress unsigned integers in packInvalid type ',' in %ssSiIlLqQjJfFdDpP(sSiIlLxXnNvV@.Malformed integer in [] in %sInvalid type '%c' in %s'X' outside of string in %sInvalid type '%c' in unpackU0 mode on a byte string%.*lu0000000000fFdDcCsSiIlLnNUWvVqQjJNegative '/' count in unpack@XxuaAZInvalid type '%c' in pack'%%' may not be used in pack$$$$$$$q$$$$$$$$$$$$$$$$W`{$$%$eE$i$i$$$C$=iеy$`$$$$$$`$$e5$$C$ɱ$$$Cײ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$q$$$$$$$$$$$$$$$$$W$$$$$$$$$$i$$$$$C$$$$$$$$$$$$$$$$$$$$$$$$$$$$$Ygd2%sy<a22+yfGu%pd<uhhhhhhhhhhhht hF F F F F F F F F F AAG?Sort subroutine didn't return single valueUndefined sort subroutine "%-p" calledUndefined subroutine in sortXS_VERSION%s::%s1.10bootstrap parameterDynaLoader.cDynaLoader::dl_load_fileDynaLoader::dl_unload_fileDynaLoader::dl_find_symbolDynaLoader::dl_undef_symbolsDynaLoader::dl_install_xsubDynaLoader::dl_errorPERL_DL_NONLAZYDynaLoaderlibhandle, symbolnamelibreffilename, flags=0%s object version %-p does not match %s%s%s%s %-pperl_name, symref, filename="$Package";4,zR| rAB K0t l<h8$X$`$Lx $$h0  $(-169=@DGk]KNUZ_diorvy}4 {MLPPQLLLLLLLLQLLLLLLLLLLLLLLLLMMMMM M(MQ0M5M:M@MGMNMUM\MaMoMMgMoMwMMMMMrMMMMMMMMMMMMMMMNNJNJNJJ$N-N3NDJPV\bhntz3z  )  !+Ly;5?EM\Uh[ E{dbmkvt~ %-64=ALO[VXW`ej]a+ {"fehpMlrzx[" $.8AGj!1LPZednw IJ>kNIJ (.pL7?UFPNTYajkrw "+3;DLQX`hpy˺ %-7@EJGRW_gcs,%w}: &/7@KU^gpyz 3"0@KUft #:R lu3E\UhanE#>6SK_rjA&6FVfv,<SK=`sO[VXW`ej]a+ {"fehpMlrzx[ "#7 KWYfo8"FVo|yJ>kNIJ.5(.pL?UFPNTYaFkr>Yi doz}zj˺%-7@EJGRW_gc,%w}:"0>IVcm| !*3<ENW`izr #[ P o 3l\i  O0Qo0oo,qoG~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~  . > N ^ n ~           . > N ^ n ~           . > N ^ n ~           . > N ^ n ~           . > N ^ n ~         .>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~.>N^n~  . > N ^ n ~         !!.!>!N!^!n!~!!!!!!!!!"".">"N"^"n"~"""""""""##.#>#N#^#n#~#########$$.$>$N$^$n$~$$$$$$$$$%%.%>%N%^%n%~%%%%%%%%%&&.&>&N&^&n&~&&&&&&&&&''.'>'N'^'n'~'''''''''((.(>(N(^(n(~((((((((()).)>)N)^)n)~)))))))))**.*>*N*^*n*~*********++.+>+N+^+n+~+++++++++,,.,>,N,^,n,~,,,,,,,,,--.->-N-^-n-~---------....>.N.^.n.~.........//./>/N/^/n/~/////////00.0>0N0^0n0~00000000011.1>1N1^1n1~11111111122.2>2N2^2n2~22222222233.3>3N3^3n3~33_ PERL_DONT_CREATE_GVSV PERL_MALLOC_WRAP USE_PERL_ATOF  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~dn Koppp1pp7p<pB(pI(pQ,pV4.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.got.plt.data.bss1 o 3 3P6 \i\ill%o,q,q2o00A 00QJ  SPPNhh0?Y33}_en m  {  <3#3#3#3#, G7H8(O?_Op `vPf Pf%s: creation of %s failed - aborting with errno %i. %s: creation of private temporary subdirectory %s failed - aborting with errno %i. $  o<0 S @o ooԠ &6FVfvƤ֤&6FVfvƥ֥&6FVfvG@0uA(k0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0u0uH1GCC: (Gentoo 4.4.4-r2 p1.3, pie-0.4.5) 4.4.4.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.comment TThh %!o<< + 00P 3S;oԠ JHo  "pW "` "@ i#d$o&L-uS{T& z    p` 0p-VFILE2207df6c/AutoLoader.pmT#line 1 "/usr/lib/perl5/5.12.2/AutoLoader.pm" package AutoLoader; use strict; use 5.006_001; our($VERSION, $AUTOLOAD); my $is_dosish; my $is_epoc; my $is_vms; my $is_macos; BEGIN { $is_dosish = $^O eq 'dos' || $^O eq 'os2' || $^O eq 'MSWin32' || $^O eq 'NetWare'; $is_epoc = $^O eq 'epoc'; $is_vms = $^O eq 'VMS'; $is_macos = $^O eq 'MacOS'; $VERSION = '5.70'; } AUTOLOAD { my $sub = $AUTOLOAD; my $filename = AutoLoader::find_filename( $sub ); my $save = $@; local $!; # Do not munge the value. eval { local $SIG{__DIE__}; require $filename }; if ($@) { if (substr($sub,-9) eq '::DESTROY') { no strict 'refs'; *$sub = sub {}; $@ = undef; } elsif ($@ =~ /^Can't locate/) { # The load might just have failed because the filename was too # long for some old SVR3 systems which treat long names as errors. # If we can successfully truncate a long name then it's worth a go. # There is a slight risk that we could pick up the wrong file here # but autosplit should have warned about that when splitting. if ($filename =~ s/(\w{12,})\.al$/substr($1,0,11).".al"/e){ eval { local $SIG{__DIE__}; require $filename }; } } if ($@){ $@ =~ s/ at .*\n//; my $error = $@; require Carp; Carp::croak($error); } } $@ = $save; goto &$sub; } sub find_filename { my $sub = shift; my $filename; # Braces used to preserve $1 et al. { # Try to find the autoloaded file from the package-qualified # name of the sub. e.g., if the sub needed is # Getopt::Long::GetOptions(), then $INC{Getopt/Long.pm} is # something like '/usr/lib/perl5/Getopt/Long.pm', and the # autoload file is '/usr/lib/perl5/auto/Getopt/Long/GetOptions.al'. # # However, if @INC is a relative path, this might not work. If, # for example, @INC = ('lib'), then $INC{Getopt/Long.pm} is # 'lib/Getopt/Long.pm', and we want to require # 'auto/Getopt/Long/GetOptions.al' (without the leading 'lib'). # In this case, we simple prepend the 'auto/' and let the # C take care of the searching for us. my ($pkg,$func) = ($sub =~ /(.*)::([^:]+)$/); $pkg =~ s#::#/#g; if (defined($filename = $INC{"$pkg.pm"})) { if ($is_macos) { $pkg =~ tr#/#:#; $filename = undef unless $filename =~ s#^(.*)$pkg\.pm\z#$1auto:$pkg:$func.al#s; } else { $filename = undef unless $filename =~ s#^(.*)$pkg\.pm\z#$1auto/$pkg/$func.al#s; } # if the file exists, then make sure that it is a # a fully anchored path (i.e either '/usr/lib/auto/foo/bar.al', # or './lib/auto/foo/bar.al'. This avoids C searching # (and failing) to find the 'lib/auto/foo/bar.al' because it # looked for 'lib/lib/auto/foo/bar.al', given @INC = ('lib'). if (defined $filename and -r $filename) { unless ($filename =~ m|^/|s) { if ($is_dosish) { unless ($filename =~ m{^([a-z]:)?[\\/]}is) { if ($^O ne 'NetWare') { $filename = "./$filename"; } else { $filename = "$filename"; } } } elsif ($is_epoc) { unless ($filename =~ m{^([a-z?]:)?[\\/]}is) { $filename = "./$filename"; } } elsif ($is_vms) { # XXX todo by VMSmiths $filename = "./$filename"; } elsif (!$is_macos) { $filename = "./$filename"; } } } else { $filename = undef; } } unless (defined $filename) { # let C do the searching $filename = "auto/$sub.al"; $filename =~ s#::#/#g; } } return $filename; } sub import { my $pkg = shift; my $callpkg = caller; # # Export symbols, but not by accident of inheritance. # if ($pkg eq 'AutoLoader') { if ( @_ and $_[0] =~ /^&?AUTOLOAD$/ ) { no strict 'refs'; *{ $callpkg . '::AUTOLOAD' } = \&AUTOLOAD; } } # # Try to find the autosplit index file. Eg., if the call package # is POSIX, then $INC{POSIX.pm} is something like # '/usr/local/lib/perl5/POSIX.pm', and the autosplit index file is in # '/usr/local/lib/perl5/auto/POSIX/autosplit.ix', so we require that. # # However, if @INC is a relative path, this might not work. If, # for example, @INC = ('lib'), then # $INC{POSIX.pm} is 'lib/POSIX.pm', and we want to require # 'auto/POSIX/autosplit.ix' (without the leading 'lib'). # (my $calldir = $callpkg) =~ s#::#/#g; my $path = $INC{$calldir . '.pm'}; if (defined($path)) { # Try absolute path name, but only eval it if the # transformation from module path to autosplit.ix path # succeeded! my $replaced_okay; if ($is_macos) { (my $malldir = $calldir) =~ tr#/#:#; $replaced_okay = ($path =~ s#^(.*)$malldir\.pm\z#$1auto:$malldir:autosplit.ix#s); } else { $replaced_okay = ($path =~ s#^(.*)$calldir\.pm\z#$1auto/$calldir/autosplit.ix#); } eval { require $path; } if $replaced_okay; # If that failed, try relative path with normal @INC searching. if (!$replaced_okay or $@) { $path ="auto/$calldir/autosplit.ix"; eval { require $path; }; } if ($@) { my $error = $@; require Carp; Carp::carp($error); } } } sub unimport { my $callpkg = caller; no strict 'refs'; for my $exported (qw( AUTOLOAD )) { my $symname = $callpkg . '::' . $exported; undef *{ $symname } if \&{ $symname } == \&{ $exported }; *{ $symname } = \&{ $symname }; } } 1; __END__ #line 430 FILE202c4264/Carp.pm"#line 1 "/usr/lib/perl5/5.12.2/Carp.pm" package Carp; our $VERSION = '1.17'; our $MaxEvalLen = 0; our $Verbose = 0; our $CarpLevel = 0; our $MaxArgLen = 64; # How much of each argument to print. 0 = all. our $MaxArgNums = 8; # How many arguments to print. 0 = all. require Exporter; our @ISA = ('Exporter'); our @EXPORT = qw(confess croak carp); our @EXPORT_OK = qw(cluck verbose longmess shortmess); our @EXPORT_FAIL = qw(verbose); # hook to enable verbose mode # The members of %Internal are packages that are internal to perl. # Carp will not report errors from within these packages if it # can. The members of %CarpInternal are internal to Perl's warning # system. Carp will not report errors from within these packages # either, and will not report calls *to* these packages for carp and # croak. They replace $CarpLevel, which is deprecated. The # $Max(EvalLen|(Arg(Len|Nums)) variables are used to specify how the eval # text and function arguments should be formatted when printed. # disable these by default, so they can live w/o require Carp $CarpInternal{Carp}++; $CarpInternal{warnings}++; $Internal{Exporter}++; $Internal{'Exporter::Heavy'}++; # if the caller specifies verbose usage ("perl -MCarp=verbose script.pl") # then the following method will be called by the Exporter which knows # to do this thanks to @EXPORT_FAIL, above. $_[1] will contain the word # 'verbose'. sub export_fail { shift; $Verbose = shift if $_[0] eq 'verbose'; @_ } sub longmess { # Icky backwards compatibility wrapper. :-( # # The story is that the original implementation hard-coded the # number of call levels to go back, so calls to longmess were off # by one. Other code began calling longmess and expecting this # behaviour, so the replacement has to emulate that behaviour. my $call_pack = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}() : caller(); if ($Internal{$call_pack} or $CarpInternal{$call_pack}) { return longmess_heavy(@_); } else { local $CarpLevel = $CarpLevel + 1; return longmess_heavy(@_); } }; sub shortmess { # Icky backwards compatibility wrapper. :-( local @CARP_NOT = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}() : caller(); shortmess_heavy(@_); }; sub croak { die shortmess @_ } sub confess { die longmess @_ } sub carp { warn shortmess @_ } sub cluck { warn longmess @_ } sub caller_info { my $i = shift(@_) + 1; my %call_info; { package DB; @args = \$i; # A sentinal, which no-one else has the address of @call_info{ qw(pack file line sub has_args wantarray evaltext is_require) } = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}($i) : caller($i); } unless (defined $call_info{pack}) { return (); } my $sub_name = Carp::get_subname(\%call_info); if ($call_info{has_args}) { my @args; if (@DB::args == 1 && ref $DB::args[0] eq ref \$i && $DB::args[0] == \$i) { @DB::args = (); # Don't let anyone see the address of $i @args = "** Incomplete caller override detected; \@DB::args were not set **"; } else { @args = map {Carp::format_arg($_)} @DB::args; } if ($MaxArgNums and @args > $MaxArgNums) { # More than we want to show? $#args = $MaxArgNums; push @args, '...'; } # Push the args onto the subroutine $sub_name .= '(' . join (', ', @args) . ')'; } $call_info{sub_name} = $sub_name; return wantarray() ? %call_info : \%call_info; } # Transform an argument to a function into a string. sub format_arg { my $arg = shift; if (ref($arg)) { $arg = defined($overload::VERSION) ? overload::StrVal($arg) : "$arg"; } if (defined($arg)) { $arg =~ s/'/\\'/g; $arg = str_len_trim($arg, $MaxArgLen); # Quote it? $arg = "'$arg'" unless $arg =~ /^-?[\d.]+\z/; } else { $arg = 'undef'; } # The following handling of "control chars" is direct from # the original code - it is broken on Unicode though. # Suggestions? utf8::is_utf8($arg) or $arg =~ s/([[:cntrl:]]|[[:^ascii:]])/sprintf("\\x{%x}",ord($1))/eg; return $arg; } # Takes an inheritance cache and a package and returns # an anon hash of known inheritances and anon array of # inheritances which consequences have not been figured # for. sub get_status { my $cache = shift; my $pkg = shift; $cache->{$pkg} ||= [{$pkg => $pkg}, [trusts_directly($pkg)]]; return @{$cache->{$pkg}}; } # Takes the info from caller() and figures out the name of # the sub/require/eval sub get_subname { my $info = shift; if (defined($info->{evaltext})) { my $eval = $info->{evaltext}; if ($info->{is_require}) { return "require $eval"; } else { $eval =~ s/([\\\'])/\\$1/g; return "eval '" . str_len_trim($eval, $MaxEvalLen) . "'"; } } return ($info->{sub} eq '(eval)') ? 'eval {...}' : $info->{sub}; } # Figures out what call (from the point of view of the caller) # the long error backtrace should start at. sub long_error_loc { my $i; my $lvl = $CarpLevel; { ++$i; my $pkg = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}($i) : caller($i); unless(defined($pkg)) { # This *shouldn't* happen. if (%Internal) { local %Internal; $i = long_error_loc(); last; } else { # OK, now I am irritated. return 2; } } redo if $CarpInternal{$pkg}; redo unless 0 > --$lvl; redo if $Internal{$pkg}; } return $i - 1; } sub longmess_heavy { return @_ if ref($_[0]); # don't break references as exceptions my $i = long_error_loc(); return ret_backtrace($i, @_); } # Returns a full stack backtrace starting from where it is # told. sub ret_backtrace { my ($i, @error) = @_; my $mess; my $err = join '', @error; $i++; my $tid_msg = ''; if (defined &threads::tid) { my $tid = threads->tid; $tid_msg = " thread $tid" if $tid; } my %i = caller_info($i); $mess = "$err at $i{file} line $i{line}$tid_msg\n"; while (my %i = caller_info(++$i)) { $mess .= "\t$i{sub_name} called at $i{file} line $i{line}$tid_msg\n"; } return $mess; } sub ret_summary { my ($i, @error) = @_; my $err = join '', @error; $i++; my $tid_msg = ''; if (defined &threads::tid) { my $tid = threads->tid; $tid_msg = " thread $tid" if $tid; } my %i = caller_info($i); return "$err at $i{file} line $i{line}$tid_msg\n"; } sub short_error_loc { # You have to create your (hash)ref out here, rather than defaulting it # inside trusts *on a lexical*, as you want it to persist across calls. # (You can default it on $_[2], but that gets messy) my $cache = {}; my $i = 1; my $lvl = $CarpLevel; { my $called = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}($i) : caller($i); $i++; my $caller = defined &{"CORE::GLOBAL::caller"} ? &{"CORE::GLOBAL::caller"}($i) : caller($i); return 0 unless defined($caller); # What happened? redo if $Internal{$caller}; redo if $CarpInternal{$caller}; redo if $CarpInternal{$called}; redo if trusts($called, $caller, $cache); redo if trusts($caller, $called, $cache); redo unless 0 > --$lvl; } return $i - 1; } sub shortmess_heavy { return longmess_heavy(@_) if $Verbose; return @_ if ref($_[0]); # don't break references as exceptions my $i = short_error_loc(); if ($i) { ret_summary($i, @_); } else { longmess_heavy(@_); } } # If a string is too long, trims it with ... sub str_len_trim { my $str = shift; my $max = shift || 0; if (2 < $max and $max < length($str)) { substr($str, $max - 3) = '...'; } return $str; } # Takes two packages and an optional cache. Says whether the # first inherits from the second. # # Recursive versions of this have to work to avoid certain # possible endless loops, and when following long chains of # inheritance are less efficient. sub trusts { my $child = shift; my $parent = shift; my $cache = shift; my ($known, $partial) = get_status($cache, $child); # Figure out consequences until we have an answer while (@$partial and not exists $known->{$parent}) { my $anc = shift @$partial; next if exists $known->{$anc}; $known->{$anc}++; my ($anc_knows, $anc_partial) = get_status($cache, $anc); my @found = keys %$anc_knows; @$known{@found} = (); push @$partial, @$anc_partial; } return exists $known->{$parent}; } # Takes a package and gives a list of those trusted directly sub trusts_directly { my $class = shift; no strict 'refs'; no warnings 'once'; return @{"$class\::CARP_NOT"} ? @{"$class\::CARP_NOT"} : @{"$class\::ISA"}; } 1; __END__ #line 539 FILE4ab8bab4/Carp/Heavy.pmO#line 1 "/usr/lib/perl5/5.12.2/Carp/Heavy.pm" package Carp; # On one line so MakeMaker will see it. use Carp; our $VERSION = $Carp::VERSION; 1; # Most of the machinery of Carp used to be there. # It has been moved in Carp.pm now, but this placeholder remains for # the benefit of modules that like to preload Carp::Heavy directly. FILEca698b19/Compress/Zlib.pm8#line 1 "/usr/lib/perl5/5.12.2/Compress/Zlib.pm" package Compress::Zlib; require 5.004 ; require Exporter; use Carp ; use IO::Handle ; use Scalar::Util qw(dualvar); use IO::Compress::Base::Common 2.024 ; use Compress::Raw::Zlib 2.024 ; use IO::Compress::Gzip 2.024 ; use IO::Uncompress::Gunzip 2.024 ; use strict ; use warnings ; use bytes ; our ($VERSION, $XS_VERSION, @ISA, @EXPORT, @EXPORT_OK, %EXPORT_TAGS); $VERSION = '2.024_01'; $XS_VERSION = $VERSION; $VERSION = eval $VERSION; @ISA = qw(Exporter); # Items to export into callers namespace by default. Note: do not export # names by default without a very good reason. Use EXPORT_OK instead. # Do not simply export all your public functions/methods/constants. @EXPORT = qw( deflateInit inflateInit compress uncompress gzopen $gzerrno ); push @EXPORT, @Compress::Raw::Zlib::EXPORT ; @EXPORT_OK = qw(memGunzip memGzip zlib_version); %EXPORT_TAGS = ( ALL => \@EXPORT ); BEGIN { *zlib_version = \&Compress::Raw::Zlib::zlib_version; } use constant FLAG_APPEND => 1 ; use constant FLAG_CRC => 2 ; use constant FLAG_ADLER => 4 ; use constant FLAG_CONSUME_INPUT => 8 ; our (@my_z_errmsg); @my_z_errmsg = ( "need dictionary", # Z_NEED_DICT 2 "stream end", # Z_STREAM_END 1 "", # Z_OK 0 "file error", # Z_ERRNO (-1) "stream error", # Z_STREAM_ERROR (-2) "data error", # Z_DATA_ERROR (-3) "insufficient memory", # Z_MEM_ERROR (-4) "buffer error", # Z_BUF_ERROR (-5) "incompatible version",# Z_VERSION_ERROR(-6) ); sub _set_gzerr { my $value = shift ; if ($value == 0) { $Compress::Zlib::gzerrno = 0 ; } elsif ($value == Z_ERRNO() || $value > 2) { $Compress::Zlib::gzerrno = $! ; } else { $Compress::Zlib::gzerrno = dualvar($value+0, $my_z_errmsg[2 - $value]); } return $value ; } sub _set_gzerr_undef { _set_gzerr(@_); return undef; } sub _save_gzerr { my $gz = shift ; my $test_eof = shift ; my $value = $gz->errorNo() || 0 ; if ($test_eof) { #my $gz = $self->[0] ; # gzread uses Z_STREAM_END to denote a successful end $value = Z_STREAM_END() if $gz->eof() && $value == 0 ; } _set_gzerr($value) ; } sub gzopen($$) { my ($file, $mode) = @_ ; my $gz ; my %defOpts = (Level => Z_DEFAULT_COMPRESSION(), Strategy => Z_DEFAULT_STRATEGY(), ); my $writing ; $writing = ! ($mode =~ /r/i) ; $writing = ($mode =~ /[wa]/i) ; $defOpts{Level} = $1 if $mode =~ /(\d)/; $defOpts{Strategy} = Z_FILTERED() if $mode =~ /f/i; $defOpts{Strategy} = Z_HUFFMAN_ONLY() if $mode =~ /h/i; $defOpts{Append} = 1 if $mode =~ /a/i; my $infDef = $writing ? 'deflate' : 'inflate'; my @params = () ; croak "gzopen: file parameter is not a filehandle or filename" unless isaFilehandle $file || isaFilename $file || (ref $file && ref $file eq 'SCALAR'); return undef unless $mode =~ /[rwa]/i ; _set_gzerr(0) ; if ($writing) { $gz = new IO::Compress::Gzip($file, Minimal => 1, AutoClose => 1, %defOpts) or $Compress::Zlib::gzerrno = $IO::Compress::Gzip::GzipError; } else { $gz = new IO::Uncompress::Gunzip($file, Transparent => 1, Append => 0, AutoClose => 1, MultiStream => 1, Strict => 0) or $Compress::Zlib::gzerrno = $IO::Uncompress::Gunzip::GunzipError; } return undef if ! defined $gz ; bless [$gz, $infDef], 'Compress::Zlib::gzFile'; } sub Compress::Zlib::gzFile::gzread { my $self = shift ; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'inflate'; my $len = defined $_[1] ? $_[1] : 4096 ; if ($self->gzeof() || $len == 0) { # Zap the output buffer to match ver 1 behaviour. $_[0] = "" ; return 0 ; } my $gz = $self->[0] ; my $status = $gz->read($_[0], $len) ; _save_gzerr($gz, 1); return $status ; } sub Compress::Zlib::gzFile::gzreadline { my $self = shift ; my $gz = $self->[0] ; { # Maintain backward compatibility with 1.x behaviour # It didn't support $/, so this can't either. local $/ = "\n" ; $_[0] = $gz->getline() ; } _save_gzerr($gz, 1); return defined $_[0] ? length $_[0] : 0 ; } sub Compress::Zlib::gzFile::gzwrite { my $self = shift ; my $gz = $self->[0] ; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'deflate'; $] >= 5.008 and (utf8::downgrade($_[0], 1) or croak "Wide character in gzwrite"); my $status = $gz->write($_[0]) ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gztell { my $self = shift ; my $gz = $self->[0] ; my $status = $gz->tell() ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzseek { my $self = shift ; my $offset = shift ; my $whence = shift ; my $gz = $self->[0] ; my $status ; eval { $status = $gz->seek($offset, $whence) ; }; if ($@) { my $error = $@; $error =~ s/^.*: /gzseek: /; $error =~ s/ at .* line \d+\s*$//; croak $error; } _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzflush { my $self = shift ; my $f = shift ; my $gz = $self->[0] ; my $status = $gz->flush($f) ; my $err = _save_gzerr($gz); return $status ? 0 : $err; } sub Compress::Zlib::gzFile::gzclose { my $self = shift ; my $gz = $self->[0] ; my $status = $gz->close() ; my $err = _save_gzerr($gz); return $status ? 0 : $err; } sub Compress::Zlib::gzFile::gzeof { my $self = shift ; my $gz = $self->[0] ; return 0 if $self->[1] ne 'inflate'; my $status = $gz->eof() ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzsetparams { my $self = shift ; croak "Usage: Compress::Zlib::gzFile::gzsetparams(file, level, strategy)" unless @_ eq 2 ; my $gz = $self->[0] ; my $level = shift ; my $strategy = shift; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'deflate'; my $status = *$gz->{Compress}->deflateParams(-Level => $level, -Strategy => $strategy); _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzerror { my $self = shift ; my $gz = $self->[0] ; return $Compress::Zlib::gzerrno ; } sub compress($;$) { my ($x, $output, $err, $in) =('', '', '', '') ; if (ref $_[0] ) { $in = $_[0] ; croak "not a scalar reference" unless ref $in eq 'SCALAR' ; } else { $in = \$_[0] ; } $] >= 5.008 and (utf8::downgrade($$in, 1) or croak "Wide character in compress"); my $level = (@_ == 2 ? $_[1] : Z_DEFAULT_COMPRESSION() ); $x = new Compress::Raw::Zlib::Deflate -AppendOutput => 1, -Level => $level or return undef ; $err = $x->deflate($in, $output) ; return undef unless $err == Z_OK() ; $err = $x->flush($output) ; return undef unless $err == Z_OK() ; return $output ; } sub uncompress($) { my ($x, $output, $err, $in) =('', '', '', '') ; if (ref $_[0] ) { $in = $_[0] ; croak "not a scalar reference" unless ref $in eq 'SCALAR' ; } else { $in = \$_[0] ; } $] >= 5.008 and (utf8::downgrade($$in, 1) or croak "Wide character in uncompress"); $x = new Compress::Raw::Zlib::Inflate -ConsumeInput => 0 or return undef ; $err = $x->inflate($in, $output) ; return undef unless $err == Z_STREAM_END() ; return $output ; } sub deflateInit(@) { my ($got) = ParseParameters(0, { 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'Level' => [1, 1, Parse_signed, Z_DEFAULT_COMPRESSION()], 'Method' => [1, 1, Parse_unsigned, Z_DEFLATED()], 'WindowBits' => [1, 1, Parse_signed, MAX_WBITS()], 'MemLevel' => [1, 1, Parse_unsigned, MAX_MEM_LEVEL()], 'Strategy' => [1, 1, Parse_unsigned, Z_DEFAULT_STRATEGY()], 'Dictionary' => [1, 1, Parse_any, ""], }, @_ ) ; croak "Compress::Zlib::deflateInit: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $obj ; my $status = 0 ; ($obj, $status) = Compress::Raw::Zlib::_deflateInit(0, $got->value('Level'), $got->value('Method'), $got->value('WindowBits'), $got->value('MemLevel'), $got->value('Strategy'), $got->value('Bufsize'), $got->value('Dictionary')) ; my $x = ($status == Z_OK() ? bless $obj, "Zlib::OldDeflate" : undef) ; return wantarray ? ($x, $status) : $x ; } sub inflateInit(@) { my ($got) = ParseParameters(0, { 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'WindowBits' => [1, 1, Parse_signed, MAX_WBITS()], 'Dictionary' => [1, 1, Parse_any, ""], }, @_) ; croak "Compress::Zlib::inflateInit: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $status = 0 ; my $obj ; ($obj, $status) = Compress::Raw::Zlib::_inflateInit(FLAG_CONSUME_INPUT, $got->value('WindowBits'), $got->value('Bufsize'), $got->value('Dictionary')) ; my $x = ($status == Z_OK() ? bless $obj, "Zlib::OldInflate" : undef) ; wantarray ? ($x, $status) : $x ; } package Zlib::OldDeflate ; our (@ISA); @ISA = qw(Compress::Raw::Zlib::deflateStream); sub deflate { my $self = shift ; my $output ; my $status = $self->SUPER::deflate($_[0], $output) ; wantarray ? ($output, $status) : $output ; } sub flush { my $self = shift ; my $output ; my $flag = shift || Compress::Zlib::Z_FINISH(); my $status = $self->SUPER::flush($output, $flag) ; wantarray ? ($output, $status) : $output ; } package Zlib::OldInflate ; our (@ISA); @ISA = qw(Compress::Raw::Zlib::inflateStream); sub inflate { my $self = shift ; my $output ; my $status = $self->SUPER::inflate($_[0], $output) ; wantarray ? ($output, $status) : $output ; } package Compress::Zlib ; use IO::Compress::Gzip::Constants 2.024 ; sub memGzip($) { my $out; # if the deflation buffer isn't a reference, make it one my $string = (ref $_[0] ? $_[0] : \$_[0]) ; $] >= 5.008 and (utf8::downgrade($$string, 1) or croak "Wide character in memGzip"); _set_gzerr(0); if ( ! IO::Compress::Gzip::gzip($string, \$out, Minimal => 1) ) { $Compress::Zlib::gzerrno = $IO::Compress::Gzip::GzipError; return undef ; } return $out; } sub _removeGzipHeader($) { my $string = shift ; return Z_DATA_ERROR() if length($$string) < GZIP_MIN_HEADER_SIZE ; my ($magic1, $magic2, $method, $flags, $time, $xflags, $oscode) = unpack ('CCCCVCC', $$string); return Z_DATA_ERROR() unless $magic1 == GZIP_ID1 and $magic2 == GZIP_ID2 and $method == Z_DEFLATED() and !($flags & GZIP_FLG_RESERVED) ; substr($$string, 0, GZIP_MIN_HEADER_SIZE) = '' ; # skip extra field if ($flags & GZIP_FLG_FEXTRA) { return Z_DATA_ERROR() if length($$string) < GZIP_FEXTRA_HEADER_SIZE ; my ($extra_len) = unpack ('v', $$string); $extra_len += GZIP_FEXTRA_HEADER_SIZE; return Z_DATA_ERROR() if length($$string) < $extra_len ; substr($$string, 0, $extra_len) = ''; } # skip orig name if ($flags & GZIP_FLG_FNAME) { my $name_end = index ($$string, GZIP_NULL_BYTE); return Z_DATA_ERROR() if $name_end == -1 ; substr($$string, 0, $name_end + 1) = ''; } # skip comment if ($flags & GZIP_FLG_FCOMMENT) { my $comment_end = index ($$string, GZIP_NULL_BYTE); return Z_DATA_ERROR() if $comment_end == -1 ; substr($$string, 0, $comment_end + 1) = ''; } # skip header crc if ($flags & GZIP_FLG_FHCRC) { return Z_DATA_ERROR() if length ($$string) < GZIP_FHCRC_SIZE ; substr($$string, 0, GZIP_FHCRC_SIZE) = ''; } return Z_OK(); } sub _ret_gun_error { $Compress::Zlib::gzerrno = $IO::Uncompress::Gunzip::GunzipError; return undef; } sub memGunzip($) { # if the buffer isn't a reference, make it one my $string = (ref $_[0] ? $_[0] : \$_[0]); $] >= 5.008 and (utf8::downgrade($$string, 1) or croak "Wide character in memGunzip"); _set_gzerr(0); my $status = _removeGzipHeader($string) ; $status == Z_OK() or return _set_gzerr_undef($status); my $bufsize = length $$string > 4096 ? length $$string : 4096 ; my $x = new Compress::Raw::Zlib::Inflate({-WindowBits => - MAX_WBITS(), -Bufsize => $bufsize}) or return _ret_gun_error(); my $output = "" ; $status = $x->inflate($string, $output); if ( $status == Z_OK() ) { _set_gzerr(Z_DATA_ERROR()); return undef; } return _ret_gun_error() if ($status != Z_STREAM_END()); if (length $$string >= 8) { my ($crc, $len) = unpack ("VV", substr($$string, 0, 8)); substr($$string, 0, 8) = ''; return _set_gzerr_undef(Z_DATA_ERROR()) unless $len == length($output) and $crc == crc32($output); } else { $$string = ''; } return $output; } # Autoload methods go after __END__, and are processed by the autosplit program. 1; __END__ #line 1484 FILEc9e71760/Exporter.pm#line 1 "/usr/lib/perl5/5.12.2/Exporter.pm" package Exporter; require 5.006; # Be lean. #use strict; #no strict 'refs'; our $Debug = 0; our $ExportLevel = 0; our $Verbose ||= 0; our $VERSION = '5.64_01'; our (%Cache); sub as_heavy { require Exporter::Heavy; # Unfortunately, this does not work if the caller is aliased as *name = \&foo # Thus the need to create a lot of identical subroutines my $c = (caller(1))[3]; $c =~ s/.*:://; \&{"Exporter::Heavy::heavy_$c"}; } sub export { goto &{as_heavy()}; } sub import { my $pkg = shift; my $callpkg = caller($ExportLevel); if ($pkg eq "Exporter" and @_ and $_[0] eq "import") { *{$callpkg."::import"} = \&import; return; } # We *need* to treat @{"$pkg\::EXPORT_FAIL"} since Carp uses it :-( my($exports, $fail) = (\@{"$pkg\::EXPORT"}, \@{"$pkg\::EXPORT_FAIL"}); return export $pkg, $callpkg, @_ if $Verbose or $Debug or @$fail > 1; my $export_cache = ($Cache{$pkg} ||= {}); my $args = @_ or @_ = @$exports; local $_; if ($args and not %$export_cache) { s/^&//, $export_cache->{$_} = 1 foreach (@$exports, @{"$pkg\::EXPORT_OK"}); } my $heavy; # Try very hard not to use {} and hence have to enter scope on the foreach # We bomb out of the loop with last as soon as heavy is set. if ($args or $fail) { ($heavy = (/\W/ or $args and not exists $export_cache->{$_} or @$fail and $_ eq $fail->[0])) and last foreach (@_); } else { ($heavy = /\W/) and last foreach (@_); } return export $pkg, $callpkg, ($args ? @_ : ()) if $heavy; local $SIG{__WARN__} = sub {require Carp; &Carp::carp}; # shortcut for the common case of no type character *{"$callpkg\::$_"} = \&{"$pkg\::$_"} foreach @_; } # Default methods sub export_fail { my $self = shift; @_; } # Unfortunately, caller(1)[3] "does not work" if the caller is aliased as # *name = \&foo. Thus the need to create a lot of identical subroutines # Otherwise we could have aliased them to export(). sub export_to_level { goto &{as_heavy()}; } sub export_tags { goto &{as_heavy()}; } sub export_ok_tags { goto &{as_heavy()}; } sub require_version { goto &{as_heavy()}; } 1; __END__ #line 582 FILEaab8c274/Exporter/Heavy.pm#line 1 "/usr/lib/perl5/5.12.2/Exporter/Heavy.pm" package Exporter::Heavy; use strict; no strict 'refs'; # On one line so MakeMaker will see it. require Exporter; our $VERSION = $Exporter::VERSION; #line 22 # # We go to a lot of trouble not to 'require Carp' at file scope, # because Carp requires Exporter, and something has to give. # sub _rebuild_cache { my ($pkg, $exports, $cache) = @_; s/^&// foreach @$exports; @{$cache}{@$exports} = (1) x @$exports; my $ok = \@{"${pkg}::EXPORT_OK"}; if (@$ok) { s/^&// foreach @$ok; @{$cache}{@$ok} = (1) x @$ok; } } sub heavy_export { # First make import warnings look like they're coming from the "use". local $SIG{__WARN__} = sub { my $text = shift; if ($text =~ s/ at \S*Exporter\S*.pm line \d+.*\n//) { require Carp; local $Carp::CarpLevel = 1; # ignore package calling us too. Carp::carp($text); } else { warn $text; } }; local $SIG{__DIE__} = sub { require Carp; local $Carp::CarpLevel = 1; # ignore package calling us too. Carp::croak("$_[0]Illegal null symbol in \@${1}::EXPORT") if $_[0] =~ /^Unable to create sub named "(.*?)::"/; }; my($pkg, $callpkg, @imports) = @_; my($type, $sym, $cache_is_current, $oops); my($exports, $export_cache) = (\@{"${pkg}::EXPORT"}, $Exporter::Cache{$pkg} ||= {}); if (@imports) { if (!%$export_cache) { _rebuild_cache ($pkg, $exports, $export_cache); $cache_is_current = 1; } if (grep m{^[/!:]}, @imports) { my $tagsref = \%{"${pkg}::EXPORT_TAGS"}; my $tagdata; my %imports; my($remove, $spec, @names, @allexports); # negated first item implies starting with default set: unshift @imports, ':DEFAULT' if $imports[0] =~ m/^!/; foreach $spec (@imports){ $remove = $spec =~ s/^!//; if ($spec =~ s/^://){ if ($spec eq 'DEFAULT'){ @names = @$exports; } elsif ($tagdata = $tagsref->{$spec}) { @names = @$tagdata; } else { warn qq["$spec" is not defined in %${pkg}::EXPORT_TAGS]; ++$oops; next; } } elsif ($spec =~ m:^/(.*)/$:){ my $patn = $1; @allexports = keys %$export_cache unless @allexports; # only do keys once @names = grep(/$patn/, @allexports); # not anchored by default } else { @names = ($spec); # is a normal symbol name } warn "Import ".($remove ? "del":"add").": @names " if $Exporter::Verbose; if ($remove) { foreach $sym (@names) { delete $imports{$sym} } } else { @imports{@names} = (1) x @names; } } @imports = keys %imports; } my @carp; foreach $sym (@imports) { if (!$export_cache->{$sym}) { if ($sym =~ m/^\d/) { $pkg->VERSION($sym); # inherit from UNIVERSAL # If the version number was the only thing specified # then we should act as if nothing was specified: if (@imports == 1) { @imports = @$exports; last; } # We need a way to emulate 'use Foo ()' but still # allow an easy version check: "use Foo 1.23, ''"; if (@imports == 2 and !$imports[1]) { @imports = (); last; } } elsif ($sym !~ s/^&// || !$export_cache->{$sym}) { # Last chance - see if they've updated EXPORT_OK since we # cached it. unless ($cache_is_current) { %$export_cache = (); _rebuild_cache ($pkg, $exports, $export_cache); $cache_is_current = 1; } if (!$export_cache->{$sym}) { # accumulate the non-exports push @carp, qq["$sym" is not exported by the $pkg module\n]; $oops++; } } } } if ($oops) { require Carp; Carp::croak("@{carp}Can't continue after import errors"); } } else { @imports = @$exports; } my($fail, $fail_cache) = (\@{"${pkg}::EXPORT_FAIL"}, $Exporter::FailCache{$pkg} ||= {}); if (@$fail) { if (!%$fail_cache) { # Build cache of symbols. Optimise the lookup by adding # barewords twice... both with and without a leading &. # (Technique could be applied to $export_cache at cost of memory) my @expanded = map { /^\w/ ? ($_, '&'.$_) : $_ } @$fail; warn "${pkg}::EXPORT_FAIL cached: @expanded" if $Exporter::Verbose; @{$fail_cache}{@expanded} = (1) x @expanded; } my @failed; foreach $sym (@imports) { push(@failed, $sym) if $fail_cache->{$sym} } if (@failed) { @failed = $pkg->export_fail(@failed); foreach $sym (@failed) { require Carp; Carp::carp(qq["$sym" is not implemented by the $pkg module ], "on this architecture"); } if (@failed) { require Carp; Carp::croak("Can't continue after import errors"); } } } warn "Importing into $callpkg from $pkg: ", join(", ",sort @imports) if $Exporter::Verbose; foreach $sym (@imports) { # shortcut for the common case of no type character (*{"${callpkg}::$sym"} = \&{"${pkg}::$sym"}, next) unless $sym =~ s/^(\W)//; $type = $1; no warnings 'once'; *{"${callpkg}::$sym"} = $type eq '&' ? \&{"${pkg}::$sym"} : $type eq '$' ? \${"${pkg}::$sym"} : $type eq '@' ? \@{"${pkg}::$sym"} : $type eq '%' ? \%{"${pkg}::$sym"} : $type eq '*' ? *{"${pkg}::$sym"} : do { require Carp; Carp::croak("Can't export symbol: $type$sym") }; } } sub heavy_export_to_level { my $pkg = shift; my $level = shift; (undef) = shift; # XXX redundant arg my $callpkg = caller($level); $pkg->export($callpkg, @_); } # Utility functions sub _push_tags { my($pkg, $var, $syms) = @_; my @nontag = (); my $export_tags = \%{"${pkg}::EXPORT_TAGS"}; push(@{"${pkg}::$var"}, map { $export_tags->{$_} ? @{$export_tags->{$_}} : scalar(push(@nontag,$_),$_) } (@$syms) ? @$syms : keys %$export_tags); if (@nontag and $^W) { # This may change to a die one day require Carp; Carp::carp(join(", ", @nontag)." are not tags of $pkg"); } } sub heavy_require_version { my($self, $wanted) = @_; my $pkg = ref $self || $self; return ${pkg}->VERSION($wanted); } sub heavy_export_tags { _push_tags((caller)[0], "EXPORT", \@_); } sub heavy_export_ok_tags { _push_tags((caller)[0], "EXPORT_OK", \@_); } 1; FILE661cf949/File/Basename.pm#line 1 "/usr/lib/perl5/5.12.2/File/Basename.pm" #line 36 package File::Basename; # File::Basename is used during the Perl build, when the re extension may # not be available, but we only actually need it if running under tainting. BEGIN { if (${^TAINT}) { require re; re->import('taint'); } } use strict; use 5.006; use warnings; our(@ISA, @EXPORT, $VERSION, $Fileparse_fstype, $Fileparse_igncase); require Exporter; @ISA = qw(Exporter); @EXPORT = qw(fileparse fileparse_set_fstype basename dirname); $VERSION = "2.78"; fileparse_set_fstype($^O); #line 102 sub fileparse { my($fullname,@suffices) = @_; unless (defined $fullname) { require Carp; Carp::croak("fileparse(): need a valid pathname"); } my $orig_type = ''; my($type,$igncase) = ($Fileparse_fstype, $Fileparse_igncase); my($taint) = substr($fullname,0,0); # Is $fullname tainted? if ($type eq "VMS" and $fullname =~ m{/} ) { # We're doing Unix emulation $orig_type = $type; $type = 'Unix'; } my($dirpath, $basename); if (grep { $type eq $_ } qw(MSDOS DOS MSWin32 Epoc)) { ($dirpath,$basename) = ($fullname =~ /^((?:.*[:\\\/])?)(.*)/s); $dirpath .= '.\\' unless $dirpath =~ /[\\\/]\z/; } elsif ($type eq "OS2") { ($dirpath,$basename) = ($fullname =~ m#^((?:.*[:\\/])?)(.*)#s); $dirpath = './' unless $dirpath; # Can't be 0 $dirpath .= '/' unless $dirpath =~ m#[\\/]\z#; } elsif ($type eq "MacOS") { ($dirpath,$basename) = ($fullname =~ /^(.*:)?(.*)/s); $dirpath = ':' unless $dirpath; } elsif ($type eq "AmigaOS") { ($dirpath,$basename) = ($fullname =~ /(.*[:\/])?(.*)/s); $dirpath = './' unless $dirpath; } elsif ($type eq 'VMS' ) { ($dirpath,$basename) = ($fullname =~ /^(.*[:>\]])?(.*)/s); $dirpath ||= ''; # should always be defined } else { # Default to Unix semantics. ($dirpath,$basename) = ($fullname =~ m{^(.*/)?(.*)}s); if ($orig_type eq 'VMS' and $fullname =~ m{^(/[^/]+/000000(/|$))(.*)}) { # dev:[000000] is top of VMS tree, similar to Unix '/' # so strip it off and treat the rest as "normal" my $devspec = $1; my $remainder = $3; ($dirpath,$basename) = ($remainder =~ m{^(.*/)?(.*)}s); $dirpath ||= ''; # should always be defined $dirpath = $devspec.$dirpath; } $dirpath = './' unless $dirpath; } my $tail = ''; my $suffix = ''; if (@suffices) { foreach $suffix (@suffices) { my $pat = ($igncase ? '(?i)' : '') . "($suffix)\$"; if ($basename =~ s/$pat//s) { $taint .= substr($suffix,0,0); $tail = $1 . $tail; } } } # Ensure taint is propgated from the path to its pieces. $tail .= $taint; wantarray ? ($basename .= $taint, $dirpath .= $taint, $tail) : ($basename .= $taint); } #line 212 sub basename { my($path) = shift; # From BSD basename(1) # The basename utility deletes any prefix ending with the last slash `/' # character present in string (after first stripping trailing slashes) _strip_trailing_sep($path); my($basename, $dirname, $suffix) = fileparse( $path, map("\Q$_\E",@_) ); # From BSD basename(1) # The suffix is not stripped if it is identical to the remaining # characters in string. if( length $suffix and !length $basename ) { $basename = $suffix; } # Ensure that basename '/' == '/' if( !length $basename ) { $basename = $dirname; } return $basename; } #line 281 sub dirname { my $path = shift; my($type) = $Fileparse_fstype; if( $type eq 'VMS' and $path =~ m{/} ) { # Parse as Unix local($File::Basename::Fileparse_fstype) = ''; return dirname($path); } my($basename, $dirname) = fileparse($path); if ($type eq 'VMS') { $dirname ||= $ENV{DEFAULT}; } elsif ($type eq 'MacOS') { if( !length($basename) && $dirname !~ /^[^:]+:\z/) { _strip_trailing_sep($dirname); ($basename,$dirname) = fileparse $dirname; } $dirname .= ":" unless $dirname =~ /:\z/; } elsif (grep { $type eq $_ } qw(MSDOS DOS MSWin32 OS2)) { _strip_trailing_sep($dirname); unless( length($basename) ) { ($basename,$dirname) = fileparse $dirname; _strip_trailing_sep($dirname); } } elsif ($type eq 'AmigaOS') { if ( $dirname =~ /:\z/) { return $dirname } chop $dirname; $dirname =~ s{[^:/]+\z}{} unless length($basename); } else { _strip_trailing_sep($dirname); unless( length($basename) ) { ($basename,$dirname) = fileparse $dirname; _strip_trailing_sep($dirname); } } $dirname; } # Strip the trailing path separator. sub _strip_trailing_sep { my $type = $Fileparse_fstype; if ($type eq 'MacOS') { $_[0] =~ s/([^:]):\z/$1/s; } elsif (grep { $type eq $_ } qw(MSDOS DOS MSWin32 OS2)) { $_[0] =~ s/([^:])[\\\/]*\z/$1/; } else { $_[0] =~ s{(.)/*\z}{$1}s; } } #line 369 BEGIN { my @Ignore_Case = qw(MacOS VMS AmigaOS OS2 RISCOS MSWin32 MSDOS DOS Epoc); my @Types = (@Ignore_Case, qw(Unix)); sub fileparse_set_fstype { my $old = $Fileparse_fstype; if (@_) { my $new_type = shift; $Fileparse_fstype = 'Unix'; # default foreach my $type (@Types) { $Fileparse_fstype = $type if $new_type =~ /^$type/i; } $Fileparse_igncase = (grep $Fileparse_fstype eq $_, @Ignore_Case) ? 1 : 0; } return $old; } } 1; #line 403FILEa40ae924/File/Copy.pm2_#line 1 "/usr/lib/perl5/5.12.2/File/Copy.pm" # File/Copy.pm. Written in 1994 by Aaron Sherman . This # source code has been placed in the public domain by the author. # Please be kind and preserve the documentation. # # Additions copyright 1996 by Charles Bailey. Permission is granted # to distribute the revised code under the same terms as Perl itself. package File::Copy; use 5.006; use strict; use warnings; use File::Spec; use Config; # During perl build, we need File::Copy but Scalar::Util might not be built yet # And then we need these games to avoid loading overload, as that will # confuse miniperl during the bootstrap of perl. my $Scalar_Util_loaded = eval q{ require Scalar::Util; require overload; 1 }; our(@ISA, @EXPORT, @EXPORT_OK, $VERSION, $Too_Big, $Syscopy_is_copy); sub copy; sub syscopy; sub cp; sub mv; $VERSION = '2.18'; require Exporter; @ISA = qw(Exporter); @EXPORT = qw(copy move); @EXPORT_OK = qw(cp mv); $Too_Big = 1024 * 1024 * 2; sub croak { require Carp; goto &Carp::croak; } sub carp { require Carp; goto &Carp::carp; } my $macfiles; if ($^O eq 'MacOS') { $macfiles = eval { require Mac::MoreFiles }; warn 'Mac::MoreFiles could not be loaded; using non-native syscopy' if $@ && $^W; } # Look up the feature settings on VMS using VMS::Feature when available. my $use_vms_feature = 0; BEGIN { if ($^O eq 'VMS') { if (eval { local $SIG{__DIE__}; require VMS::Feature; }) { $use_vms_feature = 1; } } } # Need to look up the UNIX report mode. This may become a dynamic mode # in the future. sub _vms_unix_rpt { my $unix_rpt; if ($use_vms_feature) { $unix_rpt = VMS::Feature::current("filename_unix_report"); } else { my $env_unix_rpt = $ENV{'DECC$FILENAME_UNIX_REPORT'} || ''; $unix_rpt = $env_unix_rpt =~ /^[ET1]/i; } return $unix_rpt; } # Need to look up the EFS character set mode. This may become a dynamic # mode in the future. sub _vms_efs { my $efs; if ($use_vms_feature) { $efs = VMS::Feature::current("efs_charset"); } else { my $env_efs = $ENV{'DECC$EFS_CHARSET'} || ''; $efs = $env_efs =~ /^[ET1]/i; } return $efs; } sub _catname { my($from, $to) = @_; if (not defined &basename) { require File::Basename; import File::Basename 'basename'; } if ($^O eq 'MacOS') { # a partial dir name that's valid only in the cwd (e.g. 'tmp') $to = ':' . $to if $to !~ /:/; } return File::Spec->catfile($to, basename($from)); } # _eq($from, $to) tells whether $from and $to are identical sub _eq { my ($from, $to) = map { $Scalar_Util_loaded && Scalar::Util::blessed($_) && overload::Method($_, q{""}) ? "$_" : $_ } (@_); return '' if ( (ref $from) xor (ref $to) ); return $from == $to if ref $from; return $from eq $to; } sub copy { croak("Usage: copy(FROM, TO [, BUFFERSIZE]) ") unless(@_ == 2 || @_ == 3); my $from = shift; my $to = shift; my $size; if (@_) { $size = shift(@_) + 0; croak("Bad buffer size for copy: $size\n") unless ($size > 0); } my $from_a_handle = (ref($from) ? (ref($from) eq 'GLOB' || UNIVERSAL::isa($from, 'GLOB') || UNIVERSAL::isa($from, 'IO::Handle')) : (ref(\$from) eq 'GLOB')); my $to_a_handle = (ref($to) ? (ref($to) eq 'GLOB' || UNIVERSAL::isa($to, 'GLOB') || UNIVERSAL::isa($to, 'IO::Handle')) : (ref(\$to) eq 'GLOB')); if (_eq($from, $to)) { # works for references, too carp("'$from' and '$to' are identical (not copied)"); # The "copy" was a success as the source and destination contain # the same data. return 1; } if ((($Config{d_symlink} && $Config{d_readlink}) || $Config{d_link}) && !($^O eq 'MSWin32' || $^O eq 'os2')) { my @fs = stat($from); if (@fs) { my @ts = stat($to); if (@ts && $fs[0] == $ts[0] && $fs[1] == $ts[1] && !-p $from) { carp("'$from' and '$to' are identical (not copied)"); return 0; } } } if (!$from_a_handle && !$to_a_handle && -d $to && ! -d $from) { $to = _catname($from, $to); } if (defined &syscopy && !$Syscopy_is_copy && !$to_a_handle && !($from_a_handle && $^O eq 'os2' ) # OS/2 cannot handle handles && !($from_a_handle && $^O eq 'mpeix') # and neither can MPE/iX. && !($from_a_handle && $^O eq 'MSWin32') && !($from_a_handle && $^O eq 'MacOS') && !($from_a_handle && $^O eq 'NetWare') ) { my $copy_to = $to; if ($^O eq 'VMS' && -e $from) { if (! -d $to && ! -d $from) { my $vms_efs = _vms_efs(); my $unix_rpt = _vms_unix_rpt(); my $unix_mode = 0; my $from_unix = 0; $from_unix = 1 if ($from =~ /^\.\.?$/); my $from_vms = 0; $from_vms = 1 if ($from =~ m#[\[<\]]#); # Need to know if we are in Unix mode. if ($from_vms == $from_unix) { $unix_mode = $unix_rpt; } else { $unix_mode = $from_unix; } # VMS has sticky defaults on extensions, which means that # if there is a null extension on the destination file, it # will inherit the extension of the source file # So add a '.' for a null extension. # In unix_rpt mode, the trailing dot should not be added. if ($vms_efs) { $copy_to = $to; } else { $copy_to = VMS::Filespec::vmsify($to); } my ($vol, $dirs, $file) = File::Spec->splitpath($copy_to); $file = $file . '.' unless (($file =~ /(?catpath($vol, $dirs, $file); # Get rid of the old versions to be like UNIX 1 while unlink $copy_to; } } return syscopy($from, $copy_to) || 0; } my $closefrom = 0; my $closeto = 0; my ($status, $r, $buf); local($\) = ''; my $from_h; if ($from_a_handle) { $from_h = $from; } else { open $from_h, "<", $from or goto fail_open1; binmode $from_h or die "($!,$^E)"; $closefrom = 1; } # Seems most logical to do this here, in case future changes would want to # make this croak for some reason. unless (defined $size) { $size = tied(*$from_h) ? 0 : -s $from_h || 0; $size = 1024 if ($size < 512); $size = $Too_Big if ($size > $Too_Big); } my $to_h; if ($to_a_handle) { $to_h = $to; } else { $to_h = \do { local *FH }; # XXX is this line obsolete? open $to_h, ">", $to or goto fail_open2; binmode $to_h or die "($!,$^E)"; $closeto = 1; } $! = 0; for (;;) { my ($r, $w, $t); defined($r = sysread($from_h, $buf, $size)) or goto fail_inner; last unless $r; for ($w = 0; $w < $r; $w += $t) { $t = syswrite($to_h, $buf, $r - $w, $w) or goto fail_inner; } } close($to_h) || goto fail_open2 if $closeto; close($from_h) || goto fail_open1 if $closefrom; # Use this idiom to avoid uninitialized value warning. return 1; # All of these contortions try to preserve error messages... fail_inner: if ($closeto) { $status = $!; $! = 0; close $to_h; $! = $status unless $!; } fail_open2: if ($closefrom) { $status = $!; $! = 0; close $from_h; $! = $status unless $!; } fail_open1: return 0; } sub cp { my($from,$to) = @_; my(@fromstat) = stat $from; my(@tostat) = stat $to; my $perm; return 0 unless copy(@_) and @fromstat; if (@tostat) { $perm = $tostat[2]; } else { $perm = $fromstat[2] & ~(umask || 0); @tostat = stat $to; } # Might be more robust to look for S_I* in Fcntl, but we're # trying to avoid dependence on any XS-containing modules, # since File::Copy is used during the Perl build. $perm &= 07777; if ($perm & 06000) { croak("Unable to check setuid/setgid permissions for $to: $!") unless @tostat; if ($perm & 04000 and # setuid $fromstat[4] != $tostat[4]) { # owner must match $perm &= ~06000; } if ($perm & 02000 && $> != 0) { # if not root, setgid my $ok = $fromstat[5] == $tostat[5]; # group must match if ($ok) { # and we must be in group $ok = grep { $_ == $fromstat[5] } split /\s+/, $) } $perm &= ~06000 unless $ok; } } return 0 unless @tostat; return 1 if $perm == ($tostat[2] & 07777); return eval { chmod $perm, $to; } ? 1 : 0; } sub _move { croak("Usage: move(FROM, TO) ") unless @_ == 3; my($from,$to,$fallback) = @_; my($fromsz,$tosz1,$tomt1,$tosz2,$tomt2,$sts,$ossts); if (-d $to && ! -d $from) { $to = _catname($from, $to); } ($tosz1,$tomt1) = (stat($to))[7,9]; $fromsz = -s $from; if ($^O eq 'os2' and defined $tosz1 and defined $fromsz) { # will not rename with overwrite unlink $to; } my $rename_to = $to; if (-$^O eq 'VMS' && -e $from) { if (! -d $to && ! -d $from) { my $vms_efs = _vms_efs(); my $unix_rpt = _vms_unix_rpt(); my $unix_mode = 0; my $from_unix = 0; $from_unix = 1 if ($from =~ /^\.\.?$/); my $from_vms = 0; $from_vms = 1 if ($from =~ m#[\[<\]]#); # Need to know if we are in Unix mode. if ($from_vms == $from_unix) { $unix_mode = $unix_rpt; } else { $unix_mode = $from_unix; } # VMS has sticky defaults on extensions, which means that # if there is a null extension on the destination file, it # will inherit the extension of the source file # So add a '.' for a null extension. # In unix_rpt mode, the trailing dot should not be added. if ($vms_efs) { $rename_to = $to; } else { $rename_to = VMS::Filespec::vmsify($to); } my ($vol, $dirs, $file) = File::Spec->splitpath($rename_to); $file = $file . '.' unless (($file =~ /(?catpath($vol, $dirs, $file); # Get rid of the old versions to be like UNIX 1 while unlink $rename_to; } } return 1 if rename $from, $rename_to; # Did rename return an error even though it succeeded, because $to # is on a remote NFS file system, and NFS lost the server's ack? return 1 if defined($fromsz) && !-e $from && # $from disappeared (($tosz2,$tomt2) = (stat($to))[7,9]) && # $to's there ((!defined $tosz1) || # not before or ($tosz1 != $tosz2 or $tomt1 != $tomt2)) && # was changed $tosz2 == $fromsz; # it's all there ($tosz1,$tomt1) = (stat($to))[7,9]; # just in case rename did something { local $@; eval { local $SIG{__DIE__}; $fallback->($from,$to) or die; my($atime, $mtime) = (stat($from))[8,9]; utime($atime, $mtime, $to); unlink($from) or die; }; return 1 unless $@; } ($sts,$ossts) = ($! + 0, $^E + 0); ($tosz2,$tomt2) = ((stat($to))[7,9],0,0) if defined $tomt1; unlink($to) if !defined($tomt1) or $tomt1 != $tomt2 or $tosz1 != $tosz2; ($!,$^E) = ($sts,$ossts); return 0; } sub move { _move(@_,\©); } sub mv { _move(@_,\&cp); } # &syscopy is an XSUB under OS/2 unless (defined &syscopy) { if ($^O eq 'VMS') { *syscopy = \&rmscopy; } elsif ($^O eq 'mpeix') { *syscopy = sub { return 0 unless @_ == 2; # Use the MPE cp program in order to # preserve MPE file attributes. return system('/bin/cp', '-f', $_[0], $_[1]) == 0; }; } elsif ($^O eq 'MSWin32' && defined &DynaLoader::boot_DynaLoader) { # Win32::CopyFile() fill only work if we can load Win32.xs *syscopy = sub { return 0 unless @_ == 2; return Win32::CopyFile(@_, 1); }; } elsif ($macfiles) { *syscopy = sub { my($from, $to) = @_; my($dir, $toname); return 0 unless -e $from; if ($to =~ /(.*:)([^:]+):?$/) { ($dir, $toname) = ($1, $2); } else { ($dir, $toname) = (":", $to); } unlink($to); Mac::MoreFiles::FSpFileCopy($from, $dir, $toname, 1); }; } else { $Syscopy_is_copy = 1; *syscopy = \© } } 1; __END__ #line 656 FILE4b865e94/File/Find.pmc#line 1 "/usr/lib/perl5/5.12.2/File/Find.pm" package File::Find; use 5.006; use strict; use warnings; use warnings::register; our $VERSION = '1.15'; require Exporter; require Cwd; # # Modified to ensure sub-directory traversal order is not inverded by stack # push and pops. That is remains in the same order as in the directory file, # or user pre-processing (EG:sorted). # #line 419 our @ISA = qw(Exporter); our @EXPORT = qw(find finddepth); use strict; my $Is_VMS; my $Is_MacOS; require File::Basename; require File::Spec; # Should ideally be my() not our() but local() currently # refuses to operate on lexicals our %SLnkSeen; our ($wanted_callback, $avoid_nlink, $bydepth, $no_chdir, $follow, $follow_skip, $full_check, $untaint, $untaint_skip, $untaint_pat, $pre_process, $post_process, $dangling_symlinks); sub contract_name { my ($cdir,$fn) = @_; return substr($cdir,0,rindex($cdir,'/')) if $fn eq $File::Find::current_dir; $cdir = substr($cdir,0,rindex($cdir,'/')+1); $fn =~ s|^\./||; my $abs_name= $cdir . $fn; if (substr($fn,0,3) eq '../') { 1 while $abs_name =~ s!/[^/]*/\.\./+!/!; } return $abs_name; } # return the absolute name of a directory or file sub contract_name_Mac { my ($cdir,$fn) = @_; my $abs_name; if ($fn =~ /^(:+)(.*)$/) { # valid pathname starting with a ':' my $colon_count = length ($1); if ($colon_count == 1) { $abs_name = $cdir . $2; return $abs_name; } else { # need to move up the tree, but # only if it's not a volume name for (my $i=1; $i<$colon_count; $i++) { unless ($cdir =~ /^[^:]+:$/) { # volume name $cdir =~ s/[^:]+:$//; } else { return undef; } } $abs_name = $cdir . $2; return $abs_name; } } else { # $fn may be a valid path to a directory or file or (dangling) # symlink, without a leading ':' if ( (-e $fn) || (-l $fn) ) { if ($fn =~ /^[^:]+:/) { # a volume name like DataHD:* return $fn; # $fn is already an absolute path } else { $abs_name = $cdir . $fn; return $abs_name; } } else { # argh!, $fn is not a valid directory/file return undef; } } } sub PathCombine($$) { my ($Base,$Name) = @_; my $AbsName; if ($Is_MacOS) { # $Name is the resolved symlink (always a full path on MacOS), # i.e. there's no need to call contract_name_Mac() $AbsName = $Name; # (simple) check for recursion if ( ( $Base =~ /^$AbsName/) && (-d $AbsName) ) { # recursion return undef; } } else { if (substr($Name,0,1) eq '/') { $AbsName= $Name; } else { $AbsName= contract_name($Base,$Name); } # (simple) check for recursion my $newlen= length($AbsName); if ($newlen <= length($Base)) { if (($newlen == length($Base) || substr($Base,$newlen,1) eq '/') && $AbsName eq substr($Base,0,$newlen)) { return undef; } } } return $AbsName; } sub Follow_SymLink($) { my ($AbsName) = @_; my ($NewName,$DEV, $INO); ($DEV, $INO)= lstat $AbsName; while (-l _) { if ($SLnkSeen{$DEV, $INO}++) { if ($follow_skip < 2) { die "$AbsName is encountered a second time"; } else { return undef; } } $NewName= PathCombine($AbsName, readlink($AbsName)); unless(defined $NewName) { if ($follow_skip < 2) { die "$AbsName is a recursive symbolic link"; } else { return undef; } } else { $AbsName= $NewName; } ($DEV, $INO) = lstat($AbsName); return undef unless defined $DEV; # dangling symbolic link } if ($full_check && defined $DEV && $SLnkSeen{$DEV, $INO}++) { if ( ($follow_skip < 1) || ((-d _) && ($follow_skip < 2)) ) { die "$AbsName encountered a second time"; } else { return undef; } } return $AbsName; } our($dir, $name, $fullname, $prune); sub _find_dir_symlnk($$$); sub _find_dir($$$); # check whether or not a scalar variable is tainted # (code straight from the Camel, 3rd ed., page 561) sub is_tainted_pp { my $arg = shift; my $nada = substr($arg, 0, 0); # zero-length local $@; eval { eval "# $nada" }; return length($@) != 0; } sub _find_opt { my $wanted = shift; die "invalid top directory" unless defined $_[0]; # This function must local()ize everything because callbacks may # call find() or finddepth() local %SLnkSeen; local ($wanted_callback, $avoid_nlink, $bydepth, $no_chdir, $follow, $follow_skip, $full_check, $untaint, $untaint_skip, $untaint_pat, $pre_process, $post_process, $dangling_symlinks); local($dir, $name, $fullname, $prune); local *_ = \my $a; my $cwd = $wanted->{bydepth} ? Cwd::fastcwd() : Cwd::getcwd(); if ($Is_VMS) { # VMS returns this by default in VMS format which just doesn't # work for the rest of this module. $cwd = VMS::Filespec::unixpath($cwd); # Apparently this is not expected to have a trailing space. # To attempt to make VMS/UNIX conversions mostly reversable, # a trailing slash is needed. The run-time functions ignore the # resulting double slash, but it causes the perl tests to fail. $cwd =~ s#/\z##; # This comes up in upper case now, but should be lower. # In the future this could be exact case, no need to change. } my $cwd_untainted = $cwd; my $check_t_cwd = 1; $wanted_callback = $wanted->{wanted}; $bydepth = $wanted->{bydepth}; $pre_process = $wanted->{preprocess}; $post_process = $wanted->{postprocess}; $no_chdir = $wanted->{no_chdir}; $full_check = $^O eq 'MSWin32' ? 0 : $wanted->{follow}; $follow = $^O eq 'MSWin32' ? 0 : $full_check || $wanted->{follow_fast}; $follow_skip = $wanted->{follow_skip}; $untaint = $wanted->{untaint}; $untaint_pat = $wanted->{untaint_pattern}; $untaint_skip = $wanted->{untaint_skip}; $dangling_symlinks = $wanted->{dangling_symlinks}; # for compatibility reasons (find.pl, find2perl) local our ($topdir, $topdev, $topino, $topmode, $topnlink); # a symbolic link to a directory doesn't increase the link count $avoid_nlink = $follow || $File::Find::dont_use_nlink; my ($abs_dir, $Is_Dir); Proc_Top_Item: foreach my $TOP (@_) { my $top_item = $TOP; ($topdev,$topino,$topmode,$topnlink) = $follow ? stat $top_item : lstat $top_item; if ($Is_MacOS) { $top_item = ":$top_item" if ( (-d _) && ( $top_item !~ /:/ ) ); } elsif ($^O eq 'MSWin32') { $top_item =~ s|/\z|| unless $top_item =~ m|\w:/$|; } else { $top_item =~ s|/\z|| unless $top_item eq '/'; } $Is_Dir= 0; if ($follow) { if ($Is_MacOS) { $cwd = "$cwd:" unless ($cwd =~ /:$/); # for safety if ($top_item eq $File::Find::current_dir) { $abs_dir = $cwd; } else { $abs_dir = contract_name_Mac($cwd, $top_item); unless (defined $abs_dir) { warnings::warnif "Can't determine absolute path for $top_item (No such file or directory)\n"; next Proc_Top_Item; } } } else { if (substr($top_item,0,1) eq '/') { $abs_dir = $top_item; } elsif ($top_item eq $File::Find::current_dir) { $abs_dir = $cwd; } else { # care about any ../ $top_item =~ s/\.dir\z//i if $Is_VMS; $abs_dir = contract_name("$cwd/",$top_item); } } $abs_dir= Follow_SymLink($abs_dir); unless (defined $abs_dir) { if ($dangling_symlinks) { if (ref $dangling_symlinks eq 'CODE') { $dangling_symlinks->($top_item, $cwd); } else { warnings::warnif "$top_item is a dangling symbolic link\n"; } } next Proc_Top_Item; } if (-d _) { $top_item =~ s/\.dir\z//i if $Is_VMS; _find_dir_symlnk($wanted, $abs_dir, $top_item); $Is_Dir= 1; } } else { # no follow $topdir = $top_item; unless (defined $topnlink) { warnings::warnif "Can't stat $top_item: $!\n"; next Proc_Top_Item; } if (-d _) { $top_item =~ s/\.dir\z//i if $Is_VMS; _find_dir($wanted, $top_item, $topnlink); $Is_Dir= 1; } else { $abs_dir= $top_item; } } unless ($Is_Dir) { unless (($_,$dir) = File::Basename::fileparse($abs_dir)) { if ($Is_MacOS) { ($dir,$_) = (':', $top_item); # $File::Find::dir, $_ } else { ($dir,$_) = ('./', $top_item); } } $abs_dir = $dir; if (( $untaint ) && (is_tainted($dir) )) { ( $abs_dir ) = $dir =~ m|$untaint_pat|; unless (defined $abs_dir) { if ($untaint_skip == 0) { die "directory $dir is still tainted"; } else { next Proc_Top_Item; } } } unless ($no_chdir || chdir $abs_dir) { warnings::warnif "Couldn't chdir $abs_dir: $!\n"; next Proc_Top_Item; } $name = $abs_dir . $_; # $File::Find::name $_ = $name if $no_chdir; { $wanted_callback->() }; # protect against wild "next" } unless ( $no_chdir ) { if ( ($check_t_cwd) && (($untaint) && (is_tainted($cwd) )) ) { ( $cwd_untainted ) = $cwd =~ m|$untaint_pat|; unless (defined $cwd_untainted) { die "insecure cwd in find(depth)"; } $check_t_cwd = 0; } unless (chdir $cwd_untainted) { die "Can't cd to $cwd: $!\n"; } } } } # API: # $wanted # $p_dir : "parent directory" # $nlink : what came back from the stat # preconditions: # chdir (if not no_chdir) to dir sub _find_dir($$$) { my ($wanted, $p_dir, $nlink) = @_; my ($CdLvl,$Level) = (0,0); my @Stack; my @filenames; my ($subcount,$sub_nlink); my $SE= []; my $dir_name= $p_dir; my $dir_pref; my $dir_rel = $File::Find::current_dir; my $tainted = 0; my $no_nlink; if ($Is_MacOS) { $dir_pref= ($p_dir =~ /:$/) ? $p_dir : "$p_dir:"; # preface } elsif ($^O eq 'MSWin32') { $dir_pref = ($p_dir =~ m|\w:/?$| ? $p_dir : "$p_dir/" ); } elsif ($^O eq 'VMS') { # VMS is returning trailing .dir on directories # and trailing . on files and symbolic links # in UNIX syntax. # $p_dir =~ s/\.(dir)?$//i unless $p_dir eq '.'; $dir_pref = ($p_dir =~ m/[\]>]+$/ ? $p_dir : "$p_dir/" ); } else { $dir_pref= ( $p_dir eq '/' ? '/' : "$p_dir/" ); } local ($dir, $name, $prune, *DIR); unless ( $no_chdir || ($p_dir eq $File::Find::current_dir)) { my $udir = $p_dir; if (( $untaint ) && (is_tainted($p_dir) )) { ( $udir ) = $p_dir =~ m|$untaint_pat|; unless (defined $udir) { if ($untaint_skip == 0) { die "directory $p_dir is still tainted"; } else { return; } } } unless (chdir ($Is_VMS && $udir !~ /[\/\[<]+/ ? "./$udir" : $udir)) { warnings::warnif "Can't cd to $udir: $!\n"; return; } } # push the starting directory push @Stack,[$CdLvl,$p_dir,$dir_rel,-1] if $bydepth; if ($Is_MacOS) { $p_dir = $dir_pref; # ensure trailing ':' } while (defined $SE) { unless ($bydepth) { $dir= $p_dir; # $File::Find::dir $name= $dir_name; # $File::Find::name $_= ($no_chdir ? $dir_name : $dir_rel ); # $_ # prune may happen here $prune= 0; { $wanted_callback->() }; # protect against wild "next" next if $prune; } # change to that directory unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { my $udir= $dir_rel; if ( ($untaint) && (($tainted) || ($tainted = is_tainted($dir_rel) )) ) { ( $udir ) = $dir_rel =~ m|$untaint_pat|; unless (defined $udir) { if ($untaint_skip == 0) { if ($Is_MacOS) { die "directory ($p_dir) $dir_rel is still tainted"; } else { die "directory (" . ($p_dir ne '/' ? $p_dir : '') . "/) $dir_rel is still tainted"; } } else { # $untaint_skip == 1 next; } } } unless (chdir ($Is_VMS && $udir !~ /[\/\[<]+/ ? "./$udir" : $udir)) { if ($Is_MacOS) { warnings::warnif "Can't cd to ($p_dir) $udir: $!\n"; } else { warnings::warnif "Can't cd to (" . ($p_dir ne '/' ? $p_dir : '') . "/) $udir: $!\n"; } next; } $CdLvl++; } if ($Is_MacOS) { $dir_name = "$dir_name:" unless ($dir_name =~ /:$/); } $dir= $dir_name; # $File::Find::dir # Get the list of files in the current directory. unless (opendir DIR, ($no_chdir ? $dir_name : $File::Find::current_dir)) { warnings::warnif "Can't opendir($dir_name): $!\n"; next; } @filenames = readdir DIR; closedir(DIR); @filenames = $pre_process->(@filenames) if $pre_process; push @Stack,[$CdLvl,$dir_name,"",-2] if $post_process; # default: use whatever was specifid # (if $nlink >= 2, and $avoid_nlink == 0, this will switch back) $no_nlink = $avoid_nlink; # if dir has wrong nlink count, force switch to slower stat method $no_nlink = 1 if ($nlink < 2); if ($nlink == 2 && !$no_nlink) { # This dir has no subdirectories. for my $FN (@filenames) { if ($Is_VMS) { # Big hammer here - Compensate for VMS trailing . and .dir # No win situation until this is changed, but this # will handle the majority of the cases with breaking the fewest $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); } next if $FN =~ $File::Find::skip_pattern; $name = $dir_pref . $FN; # $File::Find::name $_ = ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } else { # This dir has subdirectories. $subcount = $nlink - 2; # HACK: insert directories at this position. so as to preserve # the user pre-processed ordering of files. # EG: directory traversal is in user sorted order, not at random. my $stack_top = @Stack; for my $FN (@filenames) { next if $FN =~ $File::Find::skip_pattern; if ($subcount > 0 || $no_nlink) { # Seen all the subdirs? # check for directoriness. # stat is faster for a file in the current directory $sub_nlink = (lstat ($no_chdir ? $dir_pref . $FN : $FN))[3]; if (-d _) { --$subcount; $FN =~ s/\.dir\z//i if $Is_VMS; # HACK: replace push to preserve dir traversal order #push @Stack,[$CdLvl,$dir_name,$FN,$sub_nlink]; splice @Stack, $stack_top, 0, [$CdLvl,$dir_name,$FN,$sub_nlink]; } else { $name = $dir_pref . $FN; # $File::Find::name $_= ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } else { $name = $dir_pref . $FN; # $File::Find::name $_= ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } } } continue { while ( defined ($SE = pop @Stack) ) { ($Level, $p_dir, $dir_rel, $nlink) = @$SE; if ($CdLvl > $Level && !$no_chdir) { my $tmp; if ($Is_MacOS) { $tmp = (':' x ($CdLvl-$Level)) . ':'; } elsif ($Is_VMS) { $tmp = '[' . ('-' x ($CdLvl-$Level)) . ']'; } else { $tmp = join('/',('..') x ($CdLvl-$Level)); } die "Can't cd to $tmp from $dir_name" unless chdir ($tmp); $CdLvl = $Level; } if ($Is_MacOS) { # $pdir always has a trailing ':', except for the starting dir, # where $dir_rel eq ':' $dir_name = "$p_dir$dir_rel"; $dir_pref = "$dir_name:"; } elsif ($^O eq 'MSWin32') { $dir_name = ($p_dir =~ m|\w:/?$| ? "$p_dir$dir_rel" : "$p_dir/$dir_rel"); $dir_pref = "$dir_name/"; } elsif ($^O eq 'VMS') { if ($p_dir =~ m/[\]>]+$/) { $dir_name = $p_dir; $dir_name =~ s/([\]>]+)$/.$dir_rel$1/; $dir_pref = $dir_name; } else { $dir_name = "$p_dir/$dir_rel"; $dir_pref = "$dir_name/"; } } else { $dir_name = ($p_dir eq '/' ? "/$dir_rel" : "$p_dir/$dir_rel"); $dir_pref = "$dir_name/"; } if ( $nlink == -2 ) { $name = $dir = $p_dir; # $File::Find::name / dir $_ = $File::Find::current_dir; $post_process->(); # End-of-directory processing } elsif ( $nlink < 0 ) { # must be finddepth, report dirname now $name = $dir_name; if ($Is_MacOS) { if ($dir_rel eq ':') { # must be the top dir, where we started $name =~ s|:$||; # $File::Find::name $p_dir = "$p_dir:" unless ($p_dir =~ /:$/); } $dir = $p_dir; # $File::Find::dir $_ = ($no_chdir ? $name : $dir_rel); # $_ } else { if ( substr($name,-2) eq '/.' ) { substr($name, length($name) == 2 ? -1 : -2) = ''; } $dir = $p_dir; $_ = ($no_chdir ? $dir_name : $dir_rel ); if ( substr($_,-2) eq '/.' ) { substr($_, length($_) == 2 ? -1 : -2) = ''; } } { $wanted_callback->() }; # protect against wild "next" } else { push @Stack,[$CdLvl,$p_dir,$dir_rel,-1] if $bydepth; last; } } } } # API: # $wanted # $dir_loc : absolute location of a dir # $p_dir : "parent directory" # preconditions: # chdir (if not no_chdir) to dir sub _find_dir_symlnk($$$) { my ($wanted, $dir_loc, $p_dir) = @_; # $dir_loc is the absolute directory my @Stack; my @filenames; my $new_loc; my $updir_loc = $dir_loc; # untainted parent directory my $SE = []; my $dir_name = $p_dir; my $dir_pref; my $loc_pref; my $dir_rel = $File::Find::current_dir; my $byd_flag; # flag for pending stack entry if $bydepth my $tainted = 0; my $ok = 1; if ($Is_MacOS) { $dir_pref = ($p_dir =~ /:$/) ? "$p_dir" : "$p_dir:"; $loc_pref = ($dir_loc =~ /:$/) ? "$dir_loc" : "$dir_loc:"; } else { $dir_pref = ( $p_dir eq '/' ? '/' : "$p_dir/" ); $loc_pref = ( $dir_loc eq '/' ? '/' : "$dir_loc/" ); } local ($dir, $name, $fullname, $prune, *DIR); unless ($no_chdir) { # untaint the topdir if (( $untaint ) && (is_tainted($dir_loc) )) { ( $updir_loc ) = $dir_loc =~ m|$untaint_pat|; # parent dir, now untainted # once untainted, $updir_loc is pushed on the stack (as parent directory); # hence, we don't need to untaint the parent directory every time we chdir # to it later unless (defined $updir_loc) { if ($untaint_skip == 0) { die "directory $dir_loc is still tainted"; } else { return; } } } $ok = chdir($updir_loc) unless ($p_dir eq $File::Find::current_dir); unless ($ok) { warnings::warnif "Can't cd to $updir_loc: $!\n"; return; } } push @Stack,[$dir_loc,$updir_loc,$p_dir,$dir_rel,-1] if $bydepth; if ($Is_MacOS) { $p_dir = $dir_pref; # ensure trailing ':' } while (defined $SE) { unless ($bydepth) { # change (back) to parent directory (always untainted) unless ($no_chdir) { unless (chdir $updir_loc) { warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } $dir= $p_dir; # $File::Find::dir $name= $dir_name; # $File::Find::name $_= ($no_chdir ? $dir_name : $dir_rel ); # $_ $fullname= $dir_loc; # $File::Find::fullname # prune may happen here $prune= 0; lstat($_); # make sure file tests with '_' work { $wanted_callback->() }; # protect against wild "next" next if $prune; } # change to that directory unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { $updir_loc = $dir_loc; if ( ($untaint) && (($tainted) || ($tainted = is_tainted($dir_loc) )) ) { # untaint $dir_loc, what will be pushed on the stack as (untainted) parent dir ( $updir_loc ) = $dir_loc =~ m|$untaint_pat|; unless (defined $updir_loc) { if ($untaint_skip == 0) { die "directory $dir_loc is still tainted"; } else { next; } } } unless (chdir $updir_loc) { warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } if ($Is_MacOS) { $dir_name = "$dir_name:" unless ($dir_name =~ /:$/); } $dir = $dir_name; # $File::Find::dir # Get the list of files in the current directory. unless (opendir DIR, ($no_chdir ? $dir_loc : $File::Find::current_dir)) { warnings::warnif "Can't opendir($dir_loc): $!\n"; next; } @filenames = readdir DIR; closedir(DIR); for my $FN (@filenames) { if ($Is_VMS) { # Big hammer here - Compensate for VMS trailing . and .dir # No win situation until this is changed, but this # will handle the majority of the cases with breaking the fewest. $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); } next if $FN =~ $File::Find::skip_pattern; # follow symbolic links / do an lstat $new_loc = Follow_SymLink($loc_pref.$FN); # ignore if invalid symlink unless (defined $new_loc) { if (!defined -l _ && $dangling_symlinks) { if (ref $dangling_symlinks eq 'CODE') { $dangling_symlinks->($FN, $dir_pref); } else { warnings::warnif "$dir_pref$FN is a dangling symbolic link\n"; } } $fullname = undef; $name = $dir_pref . $FN; $_ = ($no_chdir ? $name : $FN); { $wanted_callback->() }; next; } if (-d _) { if ($Is_VMS) { $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); $new_loc =~ s/\.dir\z//i; $new_loc =~ s#\.$## if ($new_loc ne '.'); } push @Stack,[$new_loc,$updir_loc,$dir_name,$FN,1]; } else { $fullname = $new_loc; # $File::Find::fullname $name = $dir_pref . $FN; # $File::Find::name $_ = ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } } continue { while (defined($SE = pop @Stack)) { ($dir_loc, $updir_loc, $p_dir, $dir_rel, $byd_flag) = @$SE; if ($Is_MacOS) { # $p_dir always has a trailing ':', except for the starting dir, # where $dir_rel eq ':' $dir_name = "$p_dir$dir_rel"; $dir_pref = "$dir_name:"; $loc_pref = ($dir_loc =~ /:$/) ? $dir_loc : "$dir_loc:"; } else { $dir_name = ($p_dir eq '/' ? "/$dir_rel" : "$p_dir/$dir_rel"); $dir_pref = "$dir_name/"; $loc_pref = "$dir_loc/"; } if ( $byd_flag < 0 ) { # must be finddepth, report dirname now unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { unless (chdir $updir_loc) { # $updir_loc (parent dir) is always untainted warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } $fullname = $dir_loc; # $File::Find::fullname $name = $dir_name; # $File::Find::name if ($Is_MacOS) { if ($dir_rel eq ':') { # must be the top dir, where we started $name =~ s|:$||; # $File::Find::name $p_dir = "$p_dir:" unless ($p_dir =~ /:$/); } $dir = $p_dir; # $File::Find::dir $_ = ($no_chdir ? $name : $dir_rel); # $_ } else { if ( substr($name,-2) eq '/.' ) { substr($name, length($name) == 2 ? -1 : -2) = ''; # $File::Find::name } $dir = $p_dir; # $File::Find::dir $_ = ($no_chdir ? $dir_name : $dir_rel); # $_ if ( substr($_,-2) eq '/.' ) { substr($_, length($_) == 2 ? -1 : -2) = ''; } } lstat($_); # make sure file tests with '_' work { $wanted_callback->() }; # protect against wild "next" } else { push @Stack,[$dir_loc, $updir_loc, $p_dir, $dir_rel,-1] if $bydepth; last; } } } } sub wrap_wanted { my $wanted = shift; if ( ref($wanted) eq 'HASH' ) { unless( exists $wanted->{wanted} and ref( $wanted->{wanted} ) eq 'CODE' ) { die 'no &wanted subroutine given'; } if ( $wanted->{follow} || $wanted->{follow_fast}) { $wanted->{follow_skip} = 1 unless defined $wanted->{follow_skip}; } if ( $wanted->{untaint} ) { $wanted->{untaint_pattern} = $File::Find::untaint_pattern unless defined $wanted->{untaint_pattern}; $wanted->{untaint_skip} = 0 unless defined $wanted->{untaint_skip}; } return $wanted; } elsif( ref( $wanted ) eq 'CODE' ) { return { wanted => $wanted }; } else { die 'no &wanted subroutine given'; } } sub find { my $wanted = shift; _find_opt(wrap_wanted($wanted), @_); } sub finddepth { my $wanted = wrap_wanted(shift); $wanted->{bydepth} = 1; _find_opt($wanted, @_); } # default $File::Find::skip_pattern = qr/^\.{1,2}\z/; $File::Find::untaint_pattern = qr|^([-+@\w./]+)$|; # These are hard-coded for now, but may move to hint files. if ($^O eq 'VMS') { $Is_VMS = 1; $File::Find::dont_use_nlink = 1; } elsif ($^O eq 'MacOS') { $Is_MacOS = 1; $File::Find::dont_use_nlink = 1; $File::Find::skip_pattern = qr/^Icon\015\z/; $File::Find::untaint_pattern = qr|^(.+)$|; } # this _should_ work properly on all platforms # where File::Find can be expected to work $File::Find::current_dir = File::Spec->curdir || '.'; $File::Find::dont_use_nlink = 1 if $^O eq 'os2' || $^O eq 'dos' || $^O eq 'amigaos' || $^O eq 'MSWin32' || $^O eq 'interix' || $^O eq 'cygwin' || $^O eq 'epoc' || $^O eq 'qnx' || $^O eq 'nto'; # Set dont_use_nlink in your hint file if your system's stat doesn't # report the number of links in a directory as an indication # of the number of files. # See, e.g. hints/machten.sh for MachTen 2.2. unless ($File::Find::dont_use_nlink) { require Config; $File::Find::dont_use_nlink = 1 if ($Config::Config{'dont_use_nlink'}); } # We need a function that checks if a scalar is tainted. Either use the # Scalar::Util module's tainted() function or our (slower) pure Perl # fallback is_tainted_pp() { local $@; eval { require Scalar::Util }; *is_tainted = $@ ? \&is_tainted_pp : \&Scalar::Util::tainted; } 1; FILEba2c5677/File/GlobMapper.pm#line 1 "/usr/lib/perl5/5.12.2/File/GlobMapper.pm" package File::GlobMapper; use strict; use warnings; use Carp; our ($CSH_GLOB); BEGIN { if ($] < 5.006) { require File::BSDGlob; import File::BSDGlob qw(:glob) ; $CSH_GLOB = File::BSDGlob::GLOB_CSH() ; *globber = \&File::BSDGlob::csh_glob; } else { require File::Glob; import File::Glob qw(:glob) ; $CSH_GLOB = File::Glob::GLOB_CSH() ; #*globber = \&File::Glob::bsd_glob; *globber = \&File::Glob::csh_glob; } } our ($Error); our ($VERSION, @EXPORT_OK); $VERSION = '1.000'; @EXPORT_OK = qw( globmap ); our ($noPreBS, $metachars, $matchMetaRE, %mapping, %wildCount); $noPreBS = '(? '([^/]*)', '?' => '([^/])', '.' => '\.', '[' => '([', '(' => '(', ')' => ')', ); %wildCount = map { $_ => 1 } qw/ * ? . { ( [ /; sub globmap ($$;) { my $inputGlob = shift ; my $outputGlob = shift ; my $obj = new File::GlobMapper($inputGlob, $outputGlob, @_) or croak "globmap: $Error" ; return $obj->getFileMap(); } sub new { my $class = shift ; my $inputGlob = shift ; my $outputGlob = shift ; # TODO -- flags needs to default to whatever File::Glob does my $flags = shift || $CSH_GLOB ; #my $flags = shift ; $inputGlob =~ s/^\s*\<\s*//; $inputGlob =~ s/\s*\>\s*$//; $outputGlob =~ s/^\s*\<\s*//; $outputGlob =~ s/\s*\>\s*$//; my %object = ( InputGlob => $inputGlob, OutputGlob => $outputGlob, GlobFlags => $flags, Braces => 0, WildCount => 0, Pairs => [], Sigil => '#', ); my $self = bless \%object, ref($class) || $class ; $self->_parseInputGlob() or return undef ; $self->_parseOutputGlob() or return undef ; my @inputFiles = globber($self->{InputGlob}, $flags) ; if (GLOB_ERROR) { $Error = $!; return undef ; } #if (whatever) { my $missing = grep { ! -e $_ } @inputFiles ; if ($missing) { $Error = "$missing input files do not exist"; return undef ; } } $self->{InputFiles} = \@inputFiles ; $self->_getFiles() or return undef ; return $self; } sub _retError { my $string = shift ; $Error = "$string in input fileglob" ; return undef ; } sub _unmatched { my $delimeter = shift ; _retError("Unmatched $delimeter"); return undef ; } sub _parseBit { my $self = shift ; my $string = shift ; my $out = ''; my $depth = 0 ; while ($string =~ s/(.*?)$noPreBS(,|$matchMetaRE)//) { $out .= quotemeta($1) ; $out .= $mapping{$2} if defined $mapping{$2}; ++ $self->{WildCount} if $wildCount{$2} ; if ($2 eq ',') { return _unmatched "(" if $depth ; $out .= '|'; } elsif ($2 eq '(') { ++ $depth ; } elsif ($2 eq ')') { return _unmatched ")" if ! $depth ; -- $depth ; } elsif ($2 eq '[') { # TODO -- quotemeta & check no '/' # TODO -- check for \] & other \ within the [] $string =~ s#(.*?\])## or return _unmatched "[" ; $out .= "$1)" ; } elsif ($2 eq ']') { return _unmatched "]" ; } elsif ($2 eq '{' || $2 eq '}') { return _retError "Nested {} not allowed" ; } } $out .= quotemeta $string; return _unmatched "(" if $depth ; return $out ; } sub _parseInputGlob { my $self = shift ; my $string = $self->{InputGlob} ; my $inGlob = ''; # Multiple concatenated *'s don't make sense #$string =~ s#\*\*+#*# ; # TODO -- Allow space to delimit patterns? #my @strings = split /\s+/, $string ; #for my $str (@strings) my $out = ''; my $depth = 0 ; while ($string =~ s/(.*?)$noPreBS($matchMetaRE)//) { $out .= quotemeta($1) ; $out .= $mapping{$2} if defined $mapping{$2}; ++ $self->{WildCount} if $wildCount{$2} ; if ($2 eq '(') { ++ $depth ; } elsif ($2 eq ')') { return _unmatched ")" if ! $depth ; -- $depth ; } elsif ($2 eq '[') { # TODO -- quotemeta & check no '/' or '(' or ')' # TODO -- check for \] & other \ within the [] $string =~ s#(.*?\])## or return _unmatched "["; $out .= "$1)" ; } elsif ($2 eq ']') { return _unmatched "]" ; } elsif ($2 eq '}') { return _unmatched "}" ; } elsif ($2 eq '{') { # TODO -- check no '/' within the {} # TODO -- check for \} & other \ within the {} my $tmp ; unless ( $string =~ s/(.*?)$noPreBS\}//) { return _unmatched "{"; } #$string =~ s#(.*?)\}##; #my $alt = join '|', # map { quotemeta $_ } # split "$noPreBS,", $1 ; my $alt = $self->_parseBit($1); defined $alt or return 0 ; $out .= "($alt)" ; ++ $self->{Braces} ; } } return _unmatched "(" if $depth ; $out .= quotemeta $string ; $self->{InputGlob} =~ s/$noPreBS[\(\)]//g; $self->{InputPattern} = $out ; #print "# INPUT '$self->{InputGlob}' => '$out'\n"; return 1 ; } sub _parseOutputGlob { my $self = shift ; my $string = $self->{OutputGlob} ; my $maxwild = $self->{WildCount}; if ($self->{GlobFlags} & GLOB_TILDE) #if (1) { $string =~ s{ ^ ~ # find a leading tilde ( # save this in $1 [^/] # a non-slash character * # repeated 0 or more times (0 means me) ) }{ $1 ? (getpwnam($1))[7] : ( $ENV{HOME} || $ENV{LOGDIR} ) }ex; } # max #1 must be == to max no of '*' in input while ( $string =~ m/#(\d)/g ) { croak "Max wild is #$maxwild, you tried #$1" if $1 > $maxwild ; } my $noPreBS = '(?{OutputGlob}' => '$string'\n"; $self->{OutputPattern} = $string ; return 1 ; } sub _getFiles { my $self = shift ; my %outInMapping = (); my %inFiles = () ; foreach my $inFile (@{ $self->{InputFiles} }) { next if $inFiles{$inFile} ++ ; my $outFile = $inFile ; if ( $inFile =~ m/$self->{InputPattern}/ ) { no warnings 'uninitialized'; eval "\$outFile = $self->{OutputPattern};" ; if (defined $outInMapping{$outFile}) { $Error = "multiple input files map to one output file"; return undef ; } $outInMapping{$outFile} = $inFile; push @{ $self->{Pairs} }, [$inFile, $outFile]; } } return 1 ; } sub getFileMap { my $self = shift ; return $self->{Pairs} ; } sub getHash { my $self = shift ; return { map { $_->[0] => $_->[1] } @{ $self->{Pairs} } } ; } 1; __END__ #line 680FILE6ea43b8f/File/Path.pm;#line 1 "/usr/lib/perl5/5.12.2/File/Path.pm" package File::Path; use 5.005_04; use strict; use Cwd 'getcwd'; use File::Basename (); use File::Spec (); BEGIN { if ($] < 5.006) { # can't say 'opendir my $dh, $dirname' # need to initialise $dh eval "use Symbol"; } } use Exporter (); use vars qw($VERSION @ISA @EXPORT @EXPORT_OK); $VERSION = '2.08_01'; @ISA = qw(Exporter); @EXPORT = qw(mkpath rmtree); @EXPORT_OK = qw(make_path remove_tree); my $Is_VMS = $^O eq 'VMS'; my $Is_MacOS = $^O eq 'MacOS'; # These OSes complain if you want to remove a file that you have no # write permission to: my $Force_Writeable = grep {$^O eq $_} qw(amigaos dos epoc MSWin32 MacOS os2); # Unix-like systems need to stat each directory in order to detect # race condition. MS-Windows is immune to this particular attack. my $Need_Stat_Check = !($^O eq 'MSWin32'); sub _carp { require Carp; goto &Carp::carp; } sub _croak { require Carp; goto &Carp::croak; } sub _error { my $arg = shift; my $message = shift; my $object = shift; if ($arg->{error}) { $object = '' unless defined $object; $message .= ": $!" if $!; push @{${$arg->{error}}}, {$object => $message}; } else { _carp(defined($object) ? "$message for $object: $!" : "$message: $!"); } } sub make_path { push @_, {} unless @_ and UNIVERSAL::isa($_[-1],'HASH'); goto &mkpath; } sub mkpath { my $old_style = !(@_ and UNIVERSAL::isa($_[-1],'HASH')); my $arg; my $paths; if ($old_style) { my ($verbose, $mode); ($paths, $verbose, $mode) = @_; $paths = [$paths] unless UNIVERSAL::isa($paths,'ARRAY'); $arg->{verbose} = $verbose; $arg->{mode} = defined $mode ? $mode : 0777; } else { $arg = pop @_; $arg->{mode} = delete $arg->{mask} if exists $arg->{mask}; $arg->{mode} = 0777 unless exists $arg->{mode}; ${$arg->{error}} = [] if exists $arg->{error}; $arg->{owner} = delete $arg->{user} if exists $arg->{user}; $arg->{owner} = delete $arg->{uid} if exists $arg->{uid}; if (exists $arg->{owner} and $arg->{owner} =~ /\D/) { my $uid = (getpwnam $arg->{owner})[2]; if (defined $uid) { $arg->{owner} = $uid; } else { _error($arg, "unable to map $arg->{owner} to a uid, ownership not changed"); delete $arg->{owner}; } } if (exists $arg->{group} and $arg->{group} =~ /\D/) { my $gid = (getgrnam $arg->{group})[2]; if (defined $gid) { $arg->{group} = $gid; } else { _error($arg, "unable to map $arg->{group} to a gid, group ownership not changed"); delete $arg->{group}; } } if (exists $arg->{owner} and not exists $arg->{group}) { $arg->{group} = -1; # chown will leave group unchanged } if (exists $arg->{group} and not exists $arg->{owner}) { $arg->{owner} = -1; # chown will leave owner unchanged } $paths = [@_]; } return _mkpath($arg, $paths); } sub _mkpath { my $arg = shift; my $paths = shift; my(@created,$path); foreach $path (@$paths) { next unless defined($path) and length($path); $path .= '/' if $^O eq 'os2' and $path =~ /^\w:\z/s; # feature of CRT # Logic wants Unix paths, so go with the flow. if ($Is_VMS) { next if $path eq '/'; $path = VMS::Filespec::unixify($path); } next if -d $path; my $parent = File::Basename::dirname($path); unless (-d $parent or $path eq $parent) { push(@created,_mkpath($arg, [$parent])); } print "mkdir $path\n" if $arg->{verbose}; if (mkdir($path,$arg->{mode})) { push(@created, $path); if (exists $arg->{owner}) { # NB: $arg->{group} guaranteed to be set during initialisation if (!chown $arg->{owner}, $arg->{group}, $path) { _error($arg, "Cannot change ownership of $path to $arg->{owner}:$arg->{group}"); } } } else { my $save_bang = $!; my ($e, $e1) = ($save_bang, $^E); $e .= "; $e1" if $e ne $e1; # allow for another process to have created it meanwhile if (!-d $path) { $! = $save_bang; if ($arg->{error}) { push @{${$arg->{error}}}, {$path => $e}; } else { _croak("mkdir $path: $e"); } } } } return @created; } sub remove_tree { push @_, {} unless @_ and UNIVERSAL::isa($_[-1],'HASH'); goto &rmtree; } sub _is_subdir { my($dir, $test) = @_; my($dv, $dd) = File::Spec->splitpath($dir, 1); my($tv, $td) = File::Spec->splitpath($test, 1); # not on same volume return 0 if $dv ne $tv; my @d = File::Spec->splitdir($dd); my @t = File::Spec->splitdir($td); # @t can't be a subdir if it's shorter than @d return 0 if @t < @d; return join('/', @d) eq join('/', splice @t, 0, +@d); } sub rmtree { my $old_style = !(@_ and UNIVERSAL::isa($_[-1],'HASH')); my $arg; my $paths; if ($old_style) { my ($verbose, $safe); ($paths, $verbose, $safe) = @_; $arg->{verbose} = $verbose; $arg->{safe} = defined $safe ? $safe : 0; if (defined($paths) and length($paths)) { $paths = [$paths] unless UNIVERSAL::isa($paths,'ARRAY'); } else { _carp ("No root path(s) specified\n"); return 0; } } else { $arg = pop @_; ${$arg->{error}} = [] if exists $arg->{error}; ${$arg->{result}} = [] if exists $arg->{result}; $paths = [@_]; } $arg->{prefix} = ''; $arg->{depth} = 0; my @clean_path; $arg->{cwd} = getcwd() or do { _error($arg, "cannot fetch initial working directory"); return 0; }; for ($arg->{cwd}) { /\A(.*)\Z/; $_ = $1 } # untaint for my $p (@$paths) { # need to fixup case and map \ to / on Windows my $ortho_root = $^O eq 'MSWin32' ? _slash_lc($p) : $p; my $ortho_cwd = $^O eq 'MSWin32' ? _slash_lc($arg->{cwd}) : $arg->{cwd}; my $ortho_root_length = length($ortho_root); $ortho_root_length-- if $^O eq 'VMS'; # don't compare '.' with ']' if ($ortho_root_length && _is_subdir($ortho_root, $ortho_cwd)) { local $! = 0; _error($arg, "cannot remove path when cwd is $arg->{cwd}", $p); next; } if ($Is_MacOS) { $p = ":$p" unless $p =~ /:/; $p .= ":" unless $p =~ /:\z/; } elsif ($^O eq 'MSWin32') { $p =~ s{[/\\]\z}{}; } else { $p =~ s{/\z}{}; } push @clean_path, $p; } @{$arg}{qw(device inode perm)} = (lstat $arg->{cwd})[0,1] or do { _error($arg, "cannot stat initial working directory", $arg->{cwd}); return 0; }; return _rmtree($arg, \@clean_path); } sub _rmtree { my $arg = shift; my $paths = shift; my $count = 0; my $curdir = File::Spec->curdir(); my $updir = File::Spec->updir(); my (@files, $root); ROOT_DIR: foreach $root (@$paths) { # since we chdir into each directory, it may not be obvious # to figure out where we are if we generate a message about # a file name. We therefore construct a semi-canonical # filename, anchored from the directory being unlinked (as # opposed to being truly canonical, anchored from the root (/). my $canon = $arg->{prefix} ? File::Spec->catfile($arg->{prefix}, $root) : $root ; my ($ldev, $lino, $perm) = (lstat $root)[0,1,2] or next ROOT_DIR; if ( -d _ ) { $root = VMS::Filespec::vmspath(VMS::Filespec::pathify($root)) if $Is_VMS; if (!chdir($root)) { # see if we can escalate privileges to get in # (e.g. funny protection mask such as -w- instead of rwx) $perm &= 07777; my $nperm = $perm | 0700; if (!($arg->{safe} or $nperm == $perm or chmod($nperm, $root))) { _error($arg, "cannot make child directory read-write-exec", $canon); next ROOT_DIR; } elsif (!chdir($root)) { _error($arg, "cannot chdir to child", $canon); next ROOT_DIR; } } my ($cur_dev, $cur_inode, $perm) = (stat $curdir)[0,1,2] or do { _error($arg, "cannot stat current working directory", $canon); next ROOT_DIR; }; if ($Need_Stat_Check) { ($ldev eq $cur_dev and $lino eq $cur_inode) or _croak("directory $canon changed before chdir, expected dev=$ldev ino=$lino, actual dev=$cur_dev ino=$cur_inode, aborting."); } $perm &= 07777; # don't forget setuid, setgid, sticky bits my $nperm = $perm | 0700; # notabene: 0700 is for making readable in the first place, # it's also intended to change it to writable in case we have # to recurse in which case we are better than rm -rf for # subtrees with strange permissions if (!($arg->{safe} or $nperm == $perm or chmod($nperm, $curdir))) { _error($arg, "cannot make directory read+writeable", $canon); $nperm = $perm; } my $d; $d = gensym() if $] < 5.006; if (!opendir $d, $curdir) { _error($arg, "cannot opendir", $canon); @files = (); } else { no strict 'refs'; if (!defined ${"\cTAINT"} or ${"\cTAINT"}) { # Blindly untaint dir names if taint mode is # active, or any perl < 5.006 @files = map { /\A(.*)\z/s; $1 } readdir $d; } else { @files = readdir $d; } closedir $d; } if ($Is_VMS) { # Deleting large numbers of files from VMS Files-11 # filesystems is faster if done in reverse ASCIIbetical order. # include '.' to '.;' from blead patch #31775 @files = map {$_ eq '.' ? '.;' : $_} reverse @files; } @files = grep {$_ ne $updir and $_ ne $curdir} @files; if (@files) { # remove the contained files before the directory itself my $narg = {%$arg}; @{$narg}{qw(device inode cwd prefix depth)} = ($cur_dev, $cur_inode, $updir, $canon, $arg->{depth}+1); $count += _rmtree($narg, \@files); } # restore directory permissions of required now (in case the rmdir # below fails), while we are still in the directory and may do so # without a race via '.' if ($nperm != $perm and not chmod($perm, $curdir)) { _error($arg, "cannot reset chmod", $canon); } # don't leave the client code in an unexpected directory chdir($arg->{cwd}) or _croak("cannot chdir to $arg->{cwd} from $canon: $!, aborting."); # ensure that a chdir upwards didn't take us somewhere other # than we expected (see CVE-2002-0435) ($cur_dev, $cur_inode) = (stat $curdir)[0,1] or _croak("cannot stat prior working directory $arg->{cwd}: $!, aborting."); if ($Need_Stat_Check) { ($arg->{device} eq $cur_dev and $arg->{inode} eq $cur_inode) or _croak("previous directory $arg->{cwd} changed before entering $canon, expected dev=$ldev ino=$lino, actual dev=$cur_dev ino=$cur_inode, aborting."); } if ($arg->{depth} or !$arg->{keep_root}) { if ($arg->{safe} && ($Is_VMS ? !&VMS::Filespec::candelete($root) : !-w $root)) { print "skipped $root\n" if $arg->{verbose}; next ROOT_DIR; } if ($Force_Writeable and !chmod $perm | 0700, $root) { _error($arg, "cannot make directory writeable", $canon); } print "rmdir $root\n" if $arg->{verbose}; if (rmdir $root) { push @{${$arg->{result}}}, $root if $arg->{result}; ++$count; } else { _error($arg, "cannot remove directory", $canon); if ($Force_Writeable && !chmod($perm, ($Is_VMS ? VMS::Filespec::fileify($root) : $root)) ) { _error($arg, sprintf("cannot restore permissions to 0%o",$perm), $canon); } } } } else { # not a directory $root = VMS::Filespec::vmsify("./$root") if $Is_VMS && !File::Spec->file_name_is_absolute($root) && ($root !~ m/(?]+/); # not already in VMS syntax if ($arg->{safe} && ($Is_VMS ? !&VMS::Filespec::candelete($root) : !(-l $root || -w $root))) { print "skipped $root\n" if $arg->{verbose}; next ROOT_DIR; } my $nperm = $perm & 07777 | 0600; if ($Force_Writeable and $nperm != $perm and not chmod $nperm, $root) { _error($arg, "cannot make file writeable", $canon); } print "unlink $canon\n" if $arg->{verbose}; # delete all versions under VMS for (;;) { if (unlink $root) { push @{${$arg->{result}}}, $root if $arg->{result}; } else { _error($arg, "cannot unlink file", $canon); $Force_Writeable and chmod($perm, $root) or _error($arg, sprintf("cannot restore permissions to 0%o",$perm), $canon); last; } ++$count; last unless $Is_VMS && lstat $root; } } } return $count; } sub _slash_lc { # fix up slashes and case on MSWin32 so that we can determine that # c:\path\to\dir is underneath C:/Path/To my $path = shift; $path =~ tr{\\}{/}; return lc($path); } 1; __END__ #line 982 FILE420270e0/File/Temp.pm:#line 1 "/usr/lib/perl5/5.12.2/File/Temp.pm" package File::Temp; #line 138 # 5.6.0 gives us S_IWOTH, S_IWGRP, our and auto-vivifying filehandls # People would like a version on 5.004 so give them what they want :-) use 5.004; use strict; use Carp; use File::Spec 0.8; use File::Path qw/ rmtree /; use Fcntl 1.03; use IO::Seekable; # For SEEK_* use Errno; require VMS::Stdio if $^O eq 'VMS'; # pre-emptively load Carp::Heavy. If we don't when we run out of file # handles and attempt to call croak() we get an error message telling # us that Carp::Heavy won't load rather than an error telling us we # have run out of file handles. We either preload croak() or we # switch the calls to croak from _gettemp() to use die. eval { require Carp::Heavy; }; # Need the Symbol package if we are running older perl require Symbol if $] < 5.006; ### For the OO interface use base qw/ IO::Handle IO::Seekable /; use overload '""' => "STRINGIFY", fallback => 1; # use 'our' on v5.6.0 use vars qw($VERSION @EXPORT_OK %EXPORT_TAGS $DEBUG $KEEP_ALL); $DEBUG = 0; $KEEP_ALL = 0; # We are exporting functions use base qw/Exporter/; # Export list - to allow fine tuning of export table @EXPORT_OK = qw{ tempfile tempdir tmpnam tmpfile mktemp mkstemp mkstemps mkdtemp unlink0 cleanup SEEK_SET SEEK_CUR SEEK_END }; # Groups of functions for export %EXPORT_TAGS = ( 'POSIX' => [qw/ tmpnam tmpfile /], 'mktemp' => [qw/ mktemp mkstemp mkstemps mkdtemp/], 'seekable' => [qw/ SEEK_SET SEEK_CUR SEEK_END /], ); # add contents of these tags to @EXPORT Exporter::export_tags('POSIX','mktemp','seekable'); # Version number $VERSION = '0.22'; # This is a list of characters that can be used in random filenames my @CHARS = (qw/ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9 _ /); # Maximum number of tries to make a temp file before failing use constant MAX_TRIES => 1000; # Minimum number of X characters that should be in a template use constant MINX => 4; # Default template when no template supplied use constant TEMPXXX => 'X' x 10; # Constants for the security level use constant STANDARD => 0; use constant MEDIUM => 1; use constant HIGH => 2; # OPENFLAGS. If we defined the flag to use with Sysopen here this gives # us an optimisation when many temporary files are requested my $OPENFLAGS = O_CREAT | O_EXCL | O_RDWR; my $LOCKFLAG; unless ($^O eq 'MacOS') { for my $oflag (qw/ NOFOLLOW BINARY LARGEFILE NOINHERIT /) { my ($bit, $func) = (0, "Fcntl::O_" . $oflag); no strict 'refs'; $OPENFLAGS |= $bit if eval { # Make sure that redefined die handlers do not cause problems # e.g. CGI::Carp local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; $bit = &$func(); 1; }; } # Special case O_EXLOCK $LOCKFLAG = eval { local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; &Fcntl::O_EXLOCK(); }; } # On some systems the O_TEMPORARY flag can be used to tell the OS # to automatically remove the file when it is closed. This is fine # in most cases but not if tempfile is called with UNLINK=>0 and # the filename is requested -- in the case where the filename is to # be passed to another routine. This happens on windows. We overcome # this by using a second open flags variable my $OPENTEMPFLAGS = $OPENFLAGS; unless ($^O eq 'MacOS') { for my $oflag (qw/ TEMPORARY /) { my ($bit, $func) = (0, "Fcntl::O_" . $oflag); local($@); no strict 'refs'; $OPENTEMPFLAGS |= $bit if eval { # Make sure that redefined die handlers do not cause problems # e.g. CGI::Carp local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; $bit = &$func(); 1; }; } } # Private hash tracking which files have been created by each process id via the OO interface my %FILES_CREATED_BY_OBJECT; # INTERNAL ROUTINES - not to be used outside of package # Generic routine for getting a temporary filename # modelled on OpenBSD _gettemp() in mktemp.c # The template must contain X's that are to be replaced # with the random values # Arguments: # TEMPLATE - string containing the XXXXX's that is converted # to a random filename and opened if required # Optionally, a hash can also be supplied containing specific options # "open" => if true open the temp file, else just return the name # default is 0 # "mkdir"=> if true, we are creating a temp directory rather than tempfile # default is 0 # "suffixlen" => number of characters at end of PATH to be ignored. # default is 0. # "unlink_on_close" => indicates that, if possible, the OS should remove # the file as soon as it is closed. Usually indicates # use of the O_TEMPORARY flag to sysopen. # Usually irrelevant on unix # "use_exlock" => Indicates that O_EXLOCK should be used. Default is true. # Optionally a reference to a scalar can be passed into the function # On error this will be used to store the reason for the error # "ErrStr" => \$errstr # "open" and "mkdir" can not both be true # "unlink_on_close" is not used when "mkdir" is true. # The default options are equivalent to mktemp(). # Returns: # filehandle - open file handle (if called with doopen=1, else undef) # temp name - name of the temp file or directory # For example: # ($fh, $name) = _gettemp($template, "open" => 1); # for the current version, failures are associated with # stored in an error string and returned to give the reason whilst debugging # This routine is not called by any external function sub _gettemp { croak 'Usage: ($fh, $name) = _gettemp($template, OPTIONS);' unless scalar(@_) >= 1; # the internal error string - expect it to be overridden # Need this in case the caller decides not to supply us a value # need an anonymous scalar my $tempErrStr; # Default options my %options = ( "open" => 0, "mkdir" => 0, "suffixlen" => 0, "unlink_on_close" => 0, "use_exlock" => 1, "ErrStr" => \$tempErrStr, ); # Read the template my $template = shift; if (ref($template)) { # Use a warning here since we have not yet merged ErrStr carp "File::Temp::_gettemp: template must not be a reference"; return (); } # Check that the number of entries on stack are even if (scalar(@_) % 2 != 0) { # Use a warning here since we have not yet merged ErrStr carp "File::Temp::_gettemp: Must have even number of options"; return (); } # Read the options and merge with defaults %options = (%options, @_) if @_; # Make sure the error string is set to undef ${$options{ErrStr}} = undef; # Can not open the file and make a directory in a single call if ($options{"open"} && $options{"mkdir"}) { ${$options{ErrStr}} = "doopen and domkdir can not both be true\n"; return (); } # Find the start of the end of the Xs (position of last X) # Substr starts from 0 my $start = length($template) - 1 - $options{"suffixlen"}; # Check that we have at least MINX x X (e.g. 'XXXX") at the end of the string # (taking suffixlen into account). Any fewer is insecure. # Do it using substr - no reason to use a pattern match since # we know where we are looking and what we are looking for if (substr($template, $start - MINX + 1, MINX) ne 'X' x MINX) { ${$options{ErrStr}} = "The template must end with at least ". MINX . " 'X' characters\n"; return (); } # Replace all the X at the end of the substring with a # random character or just all the XX at the end of a full string. # Do it as an if, since the suffix adjusts which section to replace # and suffixlen=0 returns nothing if used in the substr directly # and generate a full path from the template my $path = _replace_XX($template, $options{"suffixlen"}); # Split the path into constituent parts - eventually we need to check # whether the directory exists # We need to know whether we are making a temp directory # or a tempfile my ($volume, $directories, $file); my $parent; # parent directory if ($options{"mkdir"}) { # There is no filename at the end ($volume, $directories, $file) = File::Spec->splitpath( $path, 1); # The parent is then $directories without the last directory # Split the directory and put it back together again my @dirs = File::Spec->splitdir($directories); # If @dirs only has one entry (i.e. the directory template) that means # we are in the current directory if ($#dirs == 0) { $parent = File::Spec->curdir; } else { if ($^O eq 'VMS') { # need volume to avoid relative dir spec $parent = File::Spec->catdir($volume, @dirs[0..$#dirs-1]); $parent = 'sys$disk:[]' if $parent eq ''; } else { # Put it back together without the last one $parent = File::Spec->catdir(@dirs[0..$#dirs-1]); # ...and attach the volume (no filename) $parent = File::Spec->catpath($volume, $parent, ''); } } } else { # Get rid of the last filename (use File::Basename for this?) ($volume, $directories, $file) = File::Spec->splitpath( $path ); # Join up without the file part $parent = File::Spec->catpath($volume,$directories,''); # If $parent is empty replace with curdir $parent = File::Spec->curdir unless $directories ne ''; } # Check that the parent directories exist # Do this even for the case where we are simply returning a name # not a file -- no point returning a name that includes a directory # that does not exist or is not writable unless (-e $parent) { ${$options{ErrStr}} = "Parent directory ($parent) does not exist"; return (); } unless (-d $parent) { ${$options{ErrStr}} = "Parent directory ($parent) is not a directory"; return (); } # Check the stickiness of the directory and chown giveaway if required # If the directory is world writable the sticky bit # must be set if (File::Temp->safe_level == MEDIUM) { my $safeerr; unless (_is_safe($parent,\$safeerr)) { ${$options{ErrStr}} = "Parent directory ($parent) is not safe ($safeerr)"; return (); } } elsif (File::Temp->safe_level == HIGH) { my $safeerr; unless (_is_verysafe($parent, \$safeerr)) { ${$options{ErrStr}} = "Parent directory ($parent) is not safe ($safeerr)"; return (); } } # Now try MAX_TRIES time to open the file for (my $i = 0; $i < MAX_TRIES; $i++) { # Try to open the file if requested if ($options{"open"}) { my $fh; # If we are running before perl5.6.0 we can not auto-vivify if ($] < 5.006) { $fh = &Symbol::gensym; } # Try to make sure this will be marked close-on-exec # XXX: Win32 doesn't respect this, nor the proper fcntl, # but may have O_NOINHERIT. This may or may not be in Fcntl. local $^F = 2; # Attempt to open the file my $open_success = undef; if ( $^O eq 'VMS' and $options{"unlink_on_close"} && !$KEEP_ALL) { # make it auto delete on close by setting FAB$V_DLT bit $fh = VMS::Stdio::vmssysopen($path, $OPENFLAGS, 0600, 'fop=dlt'); $open_success = $fh; } else { my $flags = ( ($options{"unlink_on_close"} && !$KEEP_ALL) ? $OPENTEMPFLAGS : $OPENFLAGS ); $flags |= $LOCKFLAG if (defined $LOCKFLAG && $options{use_exlock}); $open_success = sysopen($fh, $path, $flags, 0600); } if ( $open_success ) { # in case of odd umask force rw chmod(0600, $path); # Opened successfully - return file handle and name return ($fh, $path); } else { # Error opening file - abort with error # if the reason was anything but EEXIST unless ($!{EEXIST}) { ${$options{ErrStr}} = "Could not create temp file $path: $!"; return (); } # Loop round for another try } } elsif ($options{"mkdir"}) { # Open the temp directory if (mkdir( $path, 0700)) { # in case of odd umask chmod(0700, $path); return undef, $path; } else { # Abort with error if the reason for failure was anything # except EEXIST unless ($!{EEXIST}) { ${$options{ErrStr}} = "Could not create directory $path: $!"; return (); } # Loop round for another try } } else { # Return true if the file can not be found # Directory has been checked previously return (undef, $path) unless -e $path; # Try again until MAX_TRIES } # Did not successfully open the tempfile/dir # so try again with a different set of random letters # No point in trying to increment unless we have only # 1 X say and the randomness could come up with the same # file MAX_TRIES in a row. # Store current attempt - in principal this implies that the # 3rd time around the open attempt that the first temp file # name could be generated again. Probably should store each # attempt and make sure that none are repeated my $original = $path; my $counter = 0; # Stop infinite loop my $MAX_GUESS = 50; do { # Generate new name from original template $path = _replace_XX($template, $options{"suffixlen"}); $counter++; } until ($path ne $original || $counter > $MAX_GUESS); # Check for out of control looping if ($counter > $MAX_GUESS) { ${$options{ErrStr}} = "Tried to get a new temp name different to the previous value $MAX_GUESS times.\nSomething wrong with template?? ($template)"; return (); } } # If we get here, we have run out of tries ${ $options{ErrStr} } = "Have exceeded the maximum number of attempts (" . MAX_TRIES . ") to open temp file/dir"; return (); } # Internal routine to replace the XXXX... with random characters # This has to be done by _gettemp() every time it fails to # open a temp file/dir # Arguments: $template (the template with XXX), # $ignore (number of characters at end to ignore) # Returns: modified template sub _replace_XX { croak 'Usage: _replace_XX($template, $ignore)' unless scalar(@_) == 2; my ($path, $ignore) = @_; # Do it as an if, since the suffix adjusts which section to replace # and suffixlen=0 returns nothing if used in the substr directly # Alternatively, could simply set $ignore to length($path)-1 # Don't want to always use substr when not required though. my $end = ( $] >= 5.006 ? "\\z" : "\\Z" ); if ($ignore) { substr($path, 0, - $ignore) =~ s/X(?=X*$end)/$CHARS[ int( rand( @CHARS ) ) ]/ge; } else { $path =~ s/X(?=X*$end)/$CHARS[ int( rand( @CHARS ) ) ]/ge; } return $path; } # Internal routine to force a temp file to be writable after # it is created so that we can unlink it. Windows seems to occassionally # force a file to be readonly when written to certain temp locations sub _force_writable { my $file = shift; chmod 0600, $file; } # internal routine to check to see if the directory is safe # First checks to see if the directory is not owned by the # current user or root. Then checks to see if anyone else # can write to the directory and if so, checks to see if # it has the sticky bit set # Will not work on systems that do not support sticky bit #Args: directory path to check # Optionally: reference to scalar to contain error message # Returns true if the path is safe and false otherwise. # Returns undef if can not even run stat() on the path # This routine based on version written by Tom Christiansen # Presumably, by the time we actually attempt to create the # file or directory in this directory, it may not be safe # anymore... Have to run _is_safe directly after the open. sub _is_safe { my $path = shift; my $err_ref = shift; # Stat path my @info = stat($path); unless (scalar(@info)) { $$err_ref = "stat(path) returned no values"; return 0; } ; return 1 if $^O eq 'VMS'; # owner delete control at file level # Check to see whether owner is neither superuser (or a system uid) nor me # Use the effective uid from the $> variable # UID is in [4] if ($info[4] > File::Temp->top_system_uid() && $info[4] != $>) { Carp::cluck(sprintf "uid=$info[4] topuid=%s euid=$> path='$path'", File::Temp->top_system_uid()); $$err_ref = "Directory owned neither by root nor the current user" if ref($err_ref); return 0; } # check whether group or other can write file # use 066 to detect either reading or writing # use 022 to check writability # Do it with S_IWOTH and S_IWGRP for portability (maybe) # mode is in info[2] if (($info[2] & &Fcntl::S_IWGRP) || # Is group writable? ($info[2] & &Fcntl::S_IWOTH) ) { # Is world writable? # Must be a directory unless (-d $path) { $$err_ref = "Path ($path) is not a directory" if ref($err_ref); return 0; } # Must have sticky bit set unless (-k $path) { $$err_ref = "Sticky bit not set on $path when dir is group|world writable" if ref($err_ref); return 0; } } return 1; } # Internal routine to check whether a directory is safe # for temp files. Safer than _is_safe since it checks for # the possibility of chown giveaway and if that is a possibility # checks each directory in the path to see if it is safe (with _is_safe) # If _PC_CHOWN_RESTRICTED is not set, does the full test of each # directory anyway. # Takes optional second arg as scalar ref to error reason sub _is_verysafe { # Need POSIX - but only want to bother if really necessary due to overhead require POSIX; my $path = shift; print "_is_verysafe testing $path\n" if $DEBUG; return 1 if $^O eq 'VMS'; # owner delete control at file level my $err_ref = shift; # Should Get the value of _PC_CHOWN_RESTRICTED if it is defined # and If it is not there do the extensive test local($@); my $chown_restricted; $chown_restricted = &POSIX::_PC_CHOWN_RESTRICTED() if eval { &POSIX::_PC_CHOWN_RESTRICTED(); 1}; # If chown_resticted is set to some value we should test it if (defined $chown_restricted) { # Return if the current directory is safe return _is_safe($path,$err_ref) if POSIX::sysconf( $chown_restricted ); } # To reach this point either, the _PC_CHOWN_RESTRICTED symbol # was not avialable or the symbol was there but chown giveaway # is allowed. Either way, we now have to test the entire tree for # safety. # Convert path to an absolute directory if required unless (File::Spec->file_name_is_absolute($path)) { $path = File::Spec->rel2abs($path); } # Split directory into components - assume no file my ($volume, $directories, undef) = File::Spec->splitpath( $path, 1); # Slightly less efficient than having a function in File::Spec # to chop off the end of a directory or even a function that # can handle ../ in a directory tree # Sometimes splitdir() returns a blank at the end # so we will probably check the bottom directory twice in some cases my @dirs = File::Spec->splitdir($directories); # Concatenate one less directory each time around foreach my $pos (0.. $#dirs) { # Get a directory name my $dir = File::Spec->catpath($volume, File::Spec->catdir(@dirs[0.. $#dirs - $pos]), '' ); print "TESTING DIR $dir\n" if $DEBUG; # Check the directory return 0 unless _is_safe($dir,$err_ref); } return 1; } # internal routine to determine whether unlink works on this # platform for files that are currently open. # Returns true if we can, false otherwise. # Currently WinNT, OS/2 and VMS can not unlink an opened file # On VMS this is because the O_EXCL flag is used to open the # temporary file. Currently I do not know enough about the issues # on VMS to decide whether O_EXCL is a requirement. sub _can_unlink_opened_file { if ($^O eq 'MSWin32' || $^O eq 'os2' || $^O eq 'VMS' || $^O eq 'dos' || $^O eq 'MacOS') { return 0; } else { return 1; } } # internal routine to decide which security levels are allowed # see safe_level() for more information on this # Controls whether the supplied security level is allowed # $cando = _can_do_level( $level ) sub _can_do_level { # Get security level my $level = shift; # Always have to be able to do STANDARD return 1 if $level == STANDARD; # Currently, the systems that can do HIGH or MEDIUM are identical if ( $^O eq 'MSWin32' || $^O eq 'os2' || $^O eq 'cygwin' || $^O eq 'dos' || $^O eq 'MacOS' || $^O eq 'mpeix') { return 0; } else { return 1; } } # This routine sets up a deferred unlinking of a specified # filename and filehandle. It is used in the following cases: # - Called by unlink0 if an opened file can not be unlinked # - Called by tempfile() if files are to be removed on shutdown # - Called by tempdir() if directories are to be removed on shutdown # Arguments: # _deferred_unlink( $fh, $fname, $isdir ); # # - filehandle (so that it can be expclicitly closed if open # - filename (the thing we want to remove) # - isdir (flag to indicate that we are being given a directory) # [and hence no filehandle] # Status is not referred to since all the magic is done with an END block { # Will set up two lexical variables to contain all the files to be # removed. One array for files, another for directories They will # only exist in this block. # This means we only have to set up a single END block to remove # all files. # in order to prevent child processes inadvertently deleting the parent # temp files we use a hash to store the temp files and directories # created by a particular process id. # %files_to_unlink contains values that are references to an array of # array references containing the filehandle and filename associated with # the temp file. my (%files_to_unlink, %dirs_to_unlink); # Set up an end block to use these arrays END { local($., $@, $!, $^E, $?); cleanup(); } # Cleanup function. Always triggered on END but can be invoked # manually. sub cleanup { if (!$KEEP_ALL) { # Files my @files = (exists $files_to_unlink{$$} ? @{ $files_to_unlink{$$} } : () ); foreach my $file (@files) { # close the filehandle without checking its state # in order to make real sure that this is closed # if its already closed then I dont care about the answer # probably a better way to do this close($file->[0]); # file handle is [0] if (-f $file->[1]) { # file name is [1] _force_writable( $file->[1] ); # for windows unlink $file->[1] or warn "Error removing ".$file->[1]; } } # Dirs my @dirs = (exists $dirs_to_unlink{$$} ? @{ $dirs_to_unlink{$$} } : () ); foreach my $dir (@dirs) { if (-d $dir) { # Some versions of rmtree will abort if you attempt to remove # the directory you are sitting in. We protect that and turn it # into a warning. We do this because this occurs during # cleanup and so can not be caught by the user. eval { rmtree($dir, $DEBUG, 0); }; warn $@ if ($@ && $^W); } } # clear the arrays @{ $files_to_unlink{$$} } = () if exists $files_to_unlink{$$}; @{ $dirs_to_unlink{$$} } = () if exists $dirs_to_unlink{$$}; } } # This is the sub called to register a file for deferred unlinking # This could simply store the input parameters and defer everything # until the END block. For now we do a bit of checking at this # point in order to make sure that (1) we have a file/dir to delete # and (2) we have been called with the correct arguments. sub _deferred_unlink { croak 'Usage: _deferred_unlink($fh, $fname, $isdir)' unless scalar(@_) == 3; my ($fh, $fname, $isdir) = @_; warn "Setting up deferred removal of $fname\n" if $DEBUG; # If we have a directory, check that it is a directory if ($isdir) { if (-d $fname) { # Directory exists so store it # first on VMS turn []foo into [.foo] for rmtree $fname = VMS::Filespec::vmspath($fname) if $^O eq 'VMS'; $dirs_to_unlink{$$} = [] unless exists $dirs_to_unlink{$$}; push (@{ $dirs_to_unlink{$$} }, $fname); } else { carp "Request to remove directory $fname could not be completed since it does not exist!\n" if $^W; } } else { if (-f $fname) { # file exists so store handle and name for later removal $files_to_unlink{$$} = [] unless exists $files_to_unlink{$$}; push(@{ $files_to_unlink{$$} }, [$fh, $fname]); } else { carp "Request to remove file $fname could not be completed since it is not there!\n" if $^W; } } } } #line 1008 sub new { my $proto = shift; my $class = ref($proto) || $proto; # read arguments and convert keys to upper case my %args = @_; %args = map { uc($_), $args{$_} } keys %args; # see if they are unlinking (defaulting to yes) my $unlink = (exists $args{UNLINK} ? $args{UNLINK} : 1 ); delete $args{UNLINK}; # template (store it in an array so that it will # disappear from the arg list of tempfile) my @template = ( exists $args{TEMPLATE} ? $args{TEMPLATE} : () ); delete $args{TEMPLATE}; # Protect OPEN delete $args{OPEN}; # Open the file and retain file handle and file name my ($fh, $path) = tempfile( @template, %args ); print "Tmp: $fh - $path\n" if $DEBUG; # Store the filename in the scalar slot ${*$fh} = $path; # Cache the filename by pid so that the destructor can decide whether to remove it $FILES_CREATED_BY_OBJECT{$$}{$path} = 1; # Store unlink information in hash slot (plus other constructor info) %{*$fh} = %args; # create the object bless $fh, $class; # final method-based configuration $fh->unlink_on_destroy( $unlink ); return $fh; } #line 1066 sub newdir { my $self = shift; # need to handle args as in tempdir because we have to force CLEANUP # default without passing CLEANUP to tempdir my $template = (scalar(@_) % 2 == 1 ? shift(@_) : undef ); my %options = @_; my $cleanup = (exists $options{CLEANUP} ? $options{CLEANUP} : 1 ); delete $options{CLEANUP}; my $tempdir; if (defined $template) { $tempdir = tempdir( $template, %options ); } else { $tempdir = tempdir( %options ); } return bless { DIRNAME => $tempdir, CLEANUP => $cleanup, LAUNCHPID => $$, }, "File::Temp::Dir"; } #line 1101 sub filename { my $self = shift; return ${*$self}; } sub STRINGIFY { my $self = shift; return $self->filename; } #line 1131 sub unlink_on_destroy { my $self = shift; if (@_) { ${*$self}{UNLINK} = shift; } return ${*$self}{UNLINK}; } #line 1160 sub DESTROY { local($., $@, $!, $^E, $?); my $self = shift; # Make sure we always remove the file from the global hash # on destruction. This prevents the hash from growing uncontrollably # and post-destruction there is no reason to know about the file. my $file = $self->filename; my $was_created_by_proc; if (exists $FILES_CREATED_BY_OBJECT{$$}{$file}) { $was_created_by_proc = 1; delete $FILES_CREATED_BY_OBJECT{$$}{$file}; } if (${*$self}{UNLINK} && !$KEEP_ALL) { print "# ---------> Unlinking $self\n" if $DEBUG; # only delete if this process created it return unless $was_created_by_proc; # The unlink1 may fail if the file has been closed # by the caller. This leaves us with the decision # of whether to refuse to remove the file or simply # do an unlink without test. Seems to be silly # to do this when we are trying to be careful # about security _force_writable( $file ); # for windows unlink1( $self, $file ) or unlink($file); } } #line 1294 sub tempfile { # Can not check for argument count since we can have any # number of args # Default options my %options = ( "DIR" => undef, # Directory prefix "SUFFIX" => '', # Template suffix "UNLINK" => 0, # Do not unlink file on exit "OPEN" => 1, # Open file "TMPDIR" => 0, # Place tempfile in tempdir if template specified "EXLOCK" => 1, # Open file with O_EXLOCK ); # Check to see whether we have an odd or even number of arguments my $template = (scalar(@_) % 2 == 1 ? shift(@_) : undef); # Read the options and merge with defaults %options = (%options, @_) if @_; # First decision is whether or not to open the file if (! $options{"OPEN"}) { warn "tempfile(): temporary filename requested but not opened.\nPossibly unsafe, consider using tempfile() with OPEN set to true\n" if $^W; } if ($options{"DIR"} and $^O eq 'VMS') { # on VMS turn []foo into [.foo] for concatenation $options{"DIR"} = VMS::Filespec::vmspath($options{"DIR"}); } # Construct the template # Have a choice of trying to work around the mkstemp/mktemp/tmpnam etc # functions or simply constructing a template and using _gettemp() # explicitly. Go for the latter # First generate a template if not defined and prefix the directory # If no template must prefix the temp directory if (defined $template) { # End up with current directory if neither DIR not TMPDIR are set if ($options{"DIR"}) { $template = File::Spec->catfile($options{"DIR"}, $template); } elsif ($options{TMPDIR}) { $template = File::Spec->catfile(File::Spec->tmpdir, $template ); } } else { if ($options{"DIR"}) { $template = File::Spec->catfile($options{"DIR"}, TEMPXXX); } else { $template = File::Spec->catfile(File::Spec->tmpdir, TEMPXXX); } } # Now add a suffix $template .= $options{"SUFFIX"}; # Determine whether we should tell _gettemp to unlink the file # On unix this is irrelevant and can be worked out after the file is # opened (simply by unlinking the open filehandle). On Windows or VMS # we have to indicate temporary-ness when we open the file. In general # we only want a true temporary file if we are returning just the # filehandle - if the user wants the filename they probably do not # want the file to disappear as soon as they close it (which may be # important if they want a child process to use the file) # For this reason, tie unlink_on_close to the return context regardless # of OS. my $unlink_on_close = ( wantarray ? 0 : 1); # Create the file my ($fh, $path, $errstr); croak "Error in tempfile() using $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => $options{'OPEN'}, "mkdir"=> 0 , "unlink_on_close" => $unlink_on_close, "suffixlen" => length($options{'SUFFIX'}), "ErrStr" => \$errstr, "use_exlock" => $options{EXLOCK}, ) ); # Set up an exit handler that can do whatever is right for the # system. This removes files at exit when requested explicitly or when # system is asked to unlink_on_close but is unable to do so because # of OS limitations. # The latter should be achieved by using a tied filehandle. # Do not check return status since this is all done with END blocks. _deferred_unlink($fh, $path, 0) if $options{"UNLINK"}; # Return if (wantarray()) { if ($options{'OPEN'}) { return ($fh, $path); } else { return (undef, $path); } } else { # Unlink the file. It is up to unlink0 to decide what to do with # this (whether to unlink now or to defer until later) unlink0($fh, $path) or croak "Error unlinking file $path using unlink0"; # Return just the filehandle. return $fh; } } #line 1483 # ' sub tempdir { # Can not check for argument count since we can have any # number of args # Default options my %options = ( "CLEANUP" => 0, # Remove directory on exit "DIR" => '', # Root directory "TMPDIR" => 0, # Use tempdir with template ); # Check to see whether we have an odd or even number of arguments my $template = (scalar(@_) % 2 == 1 ? shift(@_) : undef ); # Read the options and merge with defaults %options = (%options, @_) if @_; # Modify or generate the template # Deal with the DIR and TMPDIR options if (defined $template) { # Need to strip directory path if using DIR or TMPDIR if ($options{'TMPDIR'} || $options{'DIR'}) { # Strip parent directory from the filename # # There is no filename at the end $template = VMS::Filespec::vmspath($template) if $^O eq 'VMS'; my ($volume, $directories, undef) = File::Spec->splitpath( $template, 1); # Last directory is then our template $template = (File::Spec->splitdir($directories))[-1]; # Prepend the supplied directory or temp dir if ($options{"DIR"}) { $template = File::Spec->catdir($options{"DIR"}, $template); } elsif ($options{TMPDIR}) { # Prepend tmpdir $template = File::Spec->catdir(File::Spec->tmpdir, $template); } } } else { if ($options{"DIR"}) { $template = File::Spec->catdir($options{"DIR"}, TEMPXXX); } else { $template = File::Spec->catdir(File::Spec->tmpdir, TEMPXXX); } } # Create the directory my $tempdir; my $suffixlen = 0; if ($^O eq 'VMS') { # dir names can end in delimiters $template =~ m/([\.\]:>]+)$/; $suffixlen = length($1); } if ( ($^O eq 'MacOS') && (substr($template, -1) eq ':') ) { # dir name has a trailing ':' ++$suffixlen; } my $errstr; croak "Error in tempdir() using $template: $errstr" unless ((undef, $tempdir) = _gettemp($template, "open" => 0, "mkdir"=> 1 , "suffixlen" => $suffixlen, "ErrStr" => \$errstr, ) ); # Install exit handler; must be dynamic to get lexical if ( $options{'CLEANUP'} && -d $tempdir) { _deferred_unlink(undef, $tempdir, 1); } # Return the dir name return $tempdir; } #line 1605 sub mkstemp { croak "Usage: mkstemp(template)" if scalar(@_) != 1; my $template = shift; my ($fh, $path, $errstr); croak "Error in mkstemp using $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => 1, "mkdir"=> 0 , "suffixlen" => 0, "ErrStr" => \$errstr, ) ); if (wantarray()) { return ($fh, $path); } else { return $fh; } } #line 1648 sub mkstemps { croak "Usage: mkstemps(template, suffix)" if scalar(@_) != 2; my $template = shift; my $suffix = shift; $template .= $suffix; my ($fh, $path, $errstr); croak "Error in mkstemps using $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => 1, "mkdir"=> 0 , "suffixlen" => length($suffix), "ErrStr" => \$errstr, ) ); if (wantarray()) { return ($fh, $path); } else { return $fh; } } #line 1691 #' # for emacs sub mkdtemp { croak "Usage: mkdtemp(template)" if scalar(@_) != 1; my $template = shift; my $suffixlen = 0; if ($^O eq 'VMS') { # dir names can end in delimiters $template =~ m/([\.\]:>]+)$/; $suffixlen = length($1); } if ( ($^O eq 'MacOS') && (substr($template, -1) eq ':') ) { # dir name has a trailing ':' ++$suffixlen; } my ($junk, $tmpdir, $errstr); croak "Error creating temp directory from template $template\: $errstr" unless (($junk, $tmpdir) = _gettemp($template, "open" => 0, "mkdir"=> 1 , "suffixlen" => $suffixlen, "ErrStr" => \$errstr, ) ); return $tmpdir; } #line 1734 sub mktemp { croak "Usage: mktemp(template)" if scalar(@_) != 1; my $template = shift; my ($tmpname, $junk, $errstr); croak "Error getting name to temp file from template $template: $errstr" unless (($junk, $tmpname) = _gettemp($template, "open" => 0, "mkdir"=> 0 , "suffixlen" => 0, "ErrStr" => \$errstr, ) ); return $tmpname; } #line 1796 sub tmpnam { # Retrieve the temporary directory name my $tmpdir = File::Spec->tmpdir; croak "Error temporary directory is not writable" if $tmpdir eq ''; # Use a ten character template and append to tmpdir my $template = File::Spec->catfile($tmpdir, TEMPXXX); if (wantarray() ) { return mkstemp($template); } else { return mktemp($template); } } #line 1832 sub tmpfile { # Simply call tmpnam() in a list context my ($fh, $file) = tmpnam(); # Make sure file is removed when filehandle is closed # This will fail on NFS unlink0($fh, $file) or return undef; return $fh; } #line 1877 sub tempnam { croak 'Usage tempnam($dir, $prefix)' unless scalar(@_) == 2; my ($dir, $prefix) = @_; # Add a string to the prefix $prefix .= 'XXXXXXXX'; # Concatenate the directory to the file my $template = File::Spec->catfile($dir, $prefix); return mktemp($template); } #line 1949 sub unlink0 { croak 'Usage: unlink0(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; cmpstat($fh, $path) or return 0; # attempt remove the file (does not work on some platforms) if (_can_unlink_opened_file()) { # return early (Without unlink) if we have been instructed to retain files. return 1 if $KEEP_ALL; # XXX: do *not* call this on a directory; possible race # resulting in recursive removal croak "unlink0: $path has become a directory!" if -d $path; unlink($path) or return 0; # Stat the filehandle my @fh = stat $fh; print "Link count = $fh[3] \n" if $DEBUG; # Make sure that the link count is zero # - Cygwin provides deferred unlinking, however, # on Win9x the link count remains 1 # On NFS the link count may still be 1 but we cant know that # we are on NFS return ( $fh[3] == 0 or $^O eq 'cygwin' ? 1 : 0); } else { _deferred_unlink($fh, $path, 0); return 1; } } #line 2014 sub cmpstat { croak 'Usage: cmpstat(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; warn "Comparing stat\n" if $DEBUG; # Stat the filehandle - which may be closed if someone has manually # closed the file. Can not turn off warnings without using $^W # unless we upgrade to 5.006 minimum requirement my @fh; { local ($^W) = 0; @fh = stat $fh; } return unless @fh; if ($fh[3] > 1 && $^W) { carp "unlink0: fstat found too many links; SB=@fh" if $^W; } # Stat the path my @path = stat $path; unless (@path) { carp "unlink0: $path is gone already" if $^W; return; } # this is no longer a file, but may be a directory, or worse unless (-f $path) { confess "panic: $path is no longer a file: SB=@fh"; } # Do comparison of each member of the array # On WinNT dev and rdev seem to be different # depending on whether it is a file or a handle. # Cannot simply compare all members of the stat return # Select the ones we can use my @okstat = (0..$#fh); # Use all by default if ($^O eq 'MSWin32') { @okstat = (1,2,3,4,5,7,8,9,10); } elsif ($^O eq 'os2') { @okstat = (0, 2..$#fh); } elsif ($^O eq 'VMS') { # device and file ID are sufficient @okstat = (0, 1); } elsif ($^O eq 'dos') { @okstat = (0,2..7,11..$#fh); } elsif ($^O eq 'mpeix') { @okstat = (0..4,8..10); } # Now compare each entry explicitly by number for (@okstat) { print "Comparing: $_ : $fh[$_] and $path[$_]\n" if $DEBUG; # Use eq rather than == since rdev, blksize, and blocks (6, 11, # and 12) will be '' on platforms that do not support them. This # is fine since we are only comparing integers. unless ($fh[$_] eq $path[$_]) { warn "Did not match $_ element of stat\n" if $DEBUG; return 0; } } return 1; } #line 2107 sub unlink1 { croak 'Usage: unlink1(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; cmpstat($fh, $path) or return 0; # Close the file close( $fh ) or return 0; # Make sure the file is writable (for windows) _force_writable( $path ); # return early (without unlink) if we have been instructed to retain files. return 1 if $KEEP_ALL; # remove the file return unlink($path); } #line 2222 { # protect from using the variable itself my $LEVEL = STANDARD; sub safe_level { my $self = shift; if (@_) { my $level = shift; if (($level != STANDARD) && ($level != MEDIUM) && ($level != HIGH)) { carp "safe_level: Specified level ($level) not STANDARD, MEDIUM or HIGH - ignoring\n" if $^W; } else { # Dont allow this on perl 5.005 or earlier if ($] < 5.006 && $level != STANDARD) { # Cant do MEDIUM or HIGH checks croak "Currently requires perl 5.006 or newer to do the safe checks"; } # Check that we are allowed to change level # Silently ignore if we can not. $LEVEL = $level if _can_do_level($level); } } return $LEVEL; } } #line 2267 { my $TopSystemUID = 10; $TopSystemUID = 197108 if $^O eq 'interix'; # "Administrator" sub top_system_uid { my $self = shift; if (@_) { my $newuid = shift; croak "top_system_uid: UIDs should be numeric" unless $newuid =~ /^\d+$/s; $TopSystemUID = $newuid; } return $TopSystemUID; } } #line 2402 package File::Temp::Dir; use File::Path qw/ rmtree /; use strict; use overload '""' => "STRINGIFY", fallback => 1; # private class specifically to support tempdir objects # created by File::Temp->newdir # ostensibly the same method interface as File::Temp but without # inheriting all the IO::Seekable methods and other cruft # Read-only - returns the name of the temp directory sub dirname { my $self = shift; return $self->{DIRNAME}; } sub STRINGIFY { my $self = shift; return $self->dirname; } sub unlink_on_destroy { my $self = shift; if (@_) { $self->{CLEANUP} = shift; } return $self->{CLEANUP}; } sub DESTROY { my $self = shift; local($., $@, $!, $^E, $?); if ($self->unlink_on_destroy && $$ == $self->{LAUNCHPID} && !$File::Temp::KEEP_ALL) { if (-d $self->{DIRNAME}) { # Some versions of rmtree will abort if you attempt to remove # the directory you are sitting in. We protect that and turn it # into a warning. We do this because this occurs during object # destruction and so can not be caught by the user. eval { rmtree($self->{DIRNAME}, $File::Temp::DEBUG, 0); }; warn $@ if ($@ && $^W); } } } 1; FILE659e6519/FileHandle.pmq#line 1 "/usr/lib/perl5/5.12.2/FileHandle.pm" package FileHandle; use 5.006; use strict; our($VERSION, @ISA, @EXPORT, @EXPORT_OK); $VERSION = "2.02"; require IO::File; @ISA = qw(IO::File); @EXPORT = qw(_IOFBF _IOLBF _IONBF); @EXPORT_OK = qw( pipe autoflush output_field_separator output_record_separator input_record_separator input_line_number format_page_number format_lines_per_page format_lines_left format_name format_top_name format_line_break_characters format_formfeed print printf getline getlines ); # # Everything we're willing to export, we must first import. # import IO::Handle grep { !defined(&$_) } @EXPORT, @EXPORT_OK; # # Some people call "FileHandle::function", so all the functions # that were in the old FileHandle class must be imported, too. # { no strict 'refs'; my %import = ( 'IO::Handle' => [qw(DESTROY new_from_fd fdopen close fileno getc ungetc gets eof flush error clearerr setbuf setvbuf _open_mode_string)], 'IO::Seekable' => [qw(seek tell getpos setpos)], 'IO::File' => [qw(new new_tmpfile open)] ); for my $pkg (keys %import) { for my $func (@{$import{$pkg}}) { my $c = *{"${pkg}::$func"}{CODE} or die "${pkg}::$func missing"; *$func = $c; } } } # # Specialized importer for Fcntl magic. # sub import { my $pkg = shift; my $callpkg = caller; require Exporter; Exporter::export($pkg, $callpkg, @_); # # If the Fcntl extension is available, # export its constants. # eval { require Fcntl; Exporter::export('Fcntl', $callpkg); }; } ################################################ # This is the only exported function we define; # the rest come from other classes. # sub pipe { my $r = new IO::Handle; my $w = new IO::Handle; CORE::pipe($r, $w) or return undef; ($r, $w); } # Rebless standard file handles bless *STDIN{IO}, "FileHandle" if ref *STDIN{IO} eq "IO::Handle"; bless *STDOUT{IO}, "FileHandle" if ref *STDOUT{IO} eq "IO::Handle"; bless *STDERR{IO}, "FileHandle" if ref *STDERR{IO} eq "IO::Handle"; 1; __END__ #line 263 FILE'8d349dbc/IO/Compress/Adapter/Deflate.pm <#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Adapter/Deflate.pm" package IO::Compress::Adapter::Deflate ; use strict; use warnings; use bytes; use IO::Compress::Base::Common 2.024 qw(:Status); use Compress::Raw::Zlib 2.024 qw(Z_OK Z_FINISH MAX_WBITS) ; our ($VERSION); $VERSION = '2.024'; sub mkCompObject { my $crc32 = shift ; my $adler32 = shift ; my $level = shift ; my $strategy = shift ; my ($def, $status) = new Compress::Raw::Zlib::Deflate -AppendOutput => 1, -CRC32 => $crc32, -ADLER32 => $adler32, -Level => $level, -Strategy => $strategy, -WindowBits => - MAX_WBITS; return (undef, "Cannot create Deflate object: $status", $status) if $status != Z_OK; return bless {'Def' => $def, 'Error' => '', } ; } sub compr { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflate($_[0], $_[1]) ; $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub flush { my $self = shift ; my $def = $self->{Def}; my $opt = $_[1] || Z_FINISH; my $status = $def->flush($_[0], $opt); $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub close { my $self = shift ; my $def = $self->{Def}; $def->flush($_[0], Z_FINISH) if defined $def ; } sub reset { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflateReset() ; $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub deflateParams { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflateParams(@_); $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "deflateParams Error: $status"; return STATUS_ERROR; } return STATUS_OK; } #sub total_out #{ # my $self = shift ; # $self->{Def}->total_out(); #} # #sub total_in #{ # my $self = shift ; # $self->{Def}->total_in(); #} sub compressedBytes { my $self = shift ; $self->{Def}->compressedBytes(); } sub uncompressedBytes { my $self = shift ; $self->{Def}->uncompressedBytes(); } sub crc32 { my $self = shift ; $self->{Def}->crc32(); } sub adler32 { my $self = shift ; $self->{Def}->adler32(); } 1; __END__ FILE54d36eea/IO/Compress/Base.pmQD#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Base.pm" package IO::Compress::Base ; require 5.004 ; use strict ; use warnings; use IO::Compress::Base::Common 2.024 ; use IO::File ; use Scalar::Util qw(blessed readonly); #use File::Glob; #require Exporter ; use Carp ; use Symbol; use bytes; our (@ISA, $VERSION); @ISA = qw(Exporter IO::File); $VERSION = '2.024'; #Can't locate object method "SWASHNEW" via package "utf8" (perhaps you forgot to load "utf8"?) at .../ext/Compress-Zlib/Gzip/blib/lib/Compress/Zlib/Common.pm line 16. sub saveStatus { my $self = shift ; ${ *$self->{ErrorNo} } = shift() + 0 ; ${ *$self->{Error} } = '' ; return ${ *$self->{ErrorNo} } ; } sub saveErrorString { my $self = shift ; my $retval = shift ; ${ *$self->{Error} } = shift ; ${ *$self->{ErrorNo} } = shift() + 0 if @_ ; return $retval; } sub croakError { my $self = shift ; $self->saveErrorString(0, $_[0]); croak $_[0]; } sub closeError { my $self = shift ; my $retval = shift ; my $errno = *$self->{ErrorNo}; my $error = ${ *$self->{Error} }; $self->close(); *$self->{ErrorNo} = $errno ; ${ *$self->{Error} } = $error ; return $retval; } sub error { my $self = shift ; return ${ *$self->{Error} } ; } sub errorNo { my $self = shift ; return ${ *$self->{ErrorNo} } ; } sub writeAt { my $self = shift ; my $offset = shift; my $data = shift; if (defined *$self->{FH}) { my $here = tell(*$self->{FH}); return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) if $here < 0 ; seek(*$self->{FH}, $offset, SEEK_SET) or return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; defined *$self->{FH}->write($data, length $data) or return $self->saveErrorString(undef, $!, $!) ; seek(*$self->{FH}, $here, SEEK_SET) or return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; } else { substr(${ *$self->{Buffer} }, $offset, length($data)) = $data ; } return 1; } sub output { my $self = shift ; my $data = shift ; my $last = shift ; return 1 if length $data == 0 && ! $last ; if ( *$self->{FilterEnvelope} ) { *_ = \$data; &{ *$self->{FilterEnvelope} }(); } if (length $data) { if ( defined *$self->{FH} ) { defined *$self->{FH}->write( $data, length $data ) or return $self->saveErrorString(0, $!, $!); } else { ${ *$self->{Buffer} } .= $data ; } } return 1; } sub getOneShotParams { return ( 'MultiStream' => [1, 1, Parse_boolean, 1], ); } sub checkParams { my $self = shift ; my $class = shift ; my $got = shift || IO::Compress::Base::Parameters::new(); $got->parse( { # Generic Parameters 'AutoClose' => [1, 1, Parse_boolean, 0], #'Encode' => [1, 1, Parse_any, undef], 'Strict' => [0, 1, Parse_boolean, 1], 'Append' => [1, 1, Parse_boolean, 0], 'BinModeIn' => [1, 1, Parse_boolean, 0], 'FilterEnvelope' => [1, 1, Parse_any, undef], $self->getExtraParams(), *$self->{OneShot} ? $self->getOneShotParams() : (), }, @_) or $self->croakError("${class}: $got->{Error}") ; return $got ; } sub _create { my $obj = shift; my $got = shift; *$obj->{Closed} = 1 ; my $class = ref $obj; $obj->croakError("$class: Missing Output parameter") if ! @_ && ! $got ; my $outValue = shift ; my $oneShot = 1 ; if (! $got) { $oneShot = 0 ; $got = $obj->checkParams($class, undef, @_) or return undef ; } my $lax = ! $got->value('Strict') ; my $outType = whatIsOutput($outValue); $obj->ckOutputParam($class, $outValue) or return undef ; if ($outType eq 'buffer') { *$obj->{Buffer} = $outValue; } else { my $buff = "" ; *$obj->{Buffer} = \$buff ; } # Merge implies Append my $merge = $got->value('Merge') ; my $appendOutput = $got->value('Append') || $merge ; *$obj->{Append} = $appendOutput; *$obj->{FilterEnvelope} = $got->value('FilterEnvelope') ; if ($merge) { # Switch off Merge mode if output file/buffer is empty/doesn't exist if (($outType eq 'buffer' && length $$outValue == 0 ) || ($outType ne 'buffer' && (! -e $outValue || (-w _ && -z _))) ) { $merge = 0 } } # If output is a file, check that it is writable #no warnings; #if ($outType eq 'filename' && -e $outValue && ! -w _) # { return $obj->saveErrorString(undef, "Output file '$outValue' is not writable" ) } if ($got->parsed('Encode')) { my $want_encoding = $got->value('Encode'); *$obj->{Encoding} = getEncoding($obj, $class, $want_encoding); } $obj->ckParams($got) or $obj->croakError("${class}: " . $obj->error()); $obj->saveStatus(STATUS_OK) ; my $status ; if (! $merge) { *$obj->{Compress} = $obj->mkComp($got) or return undef; *$obj->{UnCompSize} = new U64 ; *$obj->{CompSize} = new U64 ; if ( $outType eq 'buffer') { ${ *$obj->{Buffer} } = '' unless $appendOutput ; } else { if ($outType eq 'handle') { *$obj->{FH} = $outValue ; setBinModeOutput(*$obj->{FH}) ; $outValue->flush() ; *$obj->{Handle} = 1 ; if ($appendOutput) { seek(*$obj->{FH}, 0, SEEK_END) or return $obj->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; } } elsif ($outType eq 'filename') { no warnings; my $mode = '>' ; $mode = '>>' if $appendOutput; *$obj->{FH} = new IO::File "$mode $outValue" or return $obj->saveErrorString(undef, "cannot open file '$outValue': $!", $!) ; *$obj->{StdIO} = ($outValue eq '-'); setBinModeOutput(*$obj->{FH}) ; } } *$obj->{Header} = $obj->mkHeader($got) ; $obj->output( *$obj->{Header} ) or return undef; } else { *$obj->{Compress} = $obj->createMerge($outValue, $outType) or return undef; } *$obj->{Closed} = 0 ; *$obj->{AutoClose} = $got->value('AutoClose') ; *$obj->{Output} = $outValue; *$obj->{ClassName} = $class; *$obj->{Got} = $got; *$obj->{OneShot} = 0 ; return $obj ; } sub ckOutputParam { my $self = shift ; my $from = shift ; my $outType = whatIsOutput($_[0]); $self->croakError("$from: output parameter not a filename, filehandle or scalar ref") if ! $outType ; #$self->croakError("$from: output filename is undef or null string") #if $outType eq 'filename' && (! defined $_[0] || $_[0] eq '') ; $self->croakError("$from: output buffer is read-only") if $outType eq 'buffer' && readonly(${ $_[0] }); return 1; } sub _def { my $obj = shift ; my $class= (caller)[0] ; my $name = (caller(1))[3] ; $obj->croakError("$name: expected at least 1 parameters\n") unless @_ >= 1 ; my $input = shift ; my $haveOut = @_ ; my $output = shift ; my $x = new IO::Compress::Base::Validator($class, *$obj->{Error}, $name, $input, $output) or return undef ; push @_, $output if $haveOut && $x->{Hash}; *$obj->{OneShot} = 1 ; my $got = $obj->checkParams($name, undef, @_) or return undef ; $x->{Got} = $got ; # if ($x->{Hash}) # { # while (my($k, $v) = each %$input) # { # $v = \$input->{$k} # unless defined $v ; # # $obj->_singleTarget($x, 1, $k, $v, @_) # or return undef ; # } # # return keys %$input ; # } if ($x->{GlobMap}) { $x->{oneInput} = 1 ; foreach my $pair (@{ $x->{Pairs} }) { my ($from, $to) = @$pair ; $obj->_singleTarget($x, 1, $from, $to, @_) or return undef ; } return scalar @{ $x->{Pairs} } ; } if (! $x->{oneOutput} ) { my $inFile = ($x->{inType} eq 'filenames' || $x->{inType} eq 'filename'); $x->{inType} = $inFile ? 'filename' : 'buffer'; foreach my $in ($x->{oneInput} ? $input : @$input) { my $out ; $x->{oneInput} = 1 ; $obj->_singleTarget($x, $inFile, $in, \$out, @_) or return undef ; push @$output, \$out ; #if ($x->{outType} eq 'array') # { push @$output, \$out } #else # { $output->{$in} = \$out } } return 1 ; } # finally the 1 to 1 and n to 1 return $obj->_singleTarget($x, 1, $input, $output, @_); croak "should not be here" ; } sub _singleTarget { my $obj = shift ; my $x = shift ; my $inputIsFilename = shift; my $input = shift; if ($x->{oneInput}) { $obj->getFileInfo($x->{Got}, $input) if isaFilename($input) and $inputIsFilename ; my $z = $obj->_create($x->{Got}, @_) or return undef ; defined $z->_wr2($input, $inputIsFilename) or return $z->closeError(undef) ; return $z->close() ; } else { my $afterFirst = 0 ; my $inputIsFilename = ($x->{inType} ne 'array'); my $keep = $x->{Got}->clone(); #for my $element ( ($x->{inType} eq 'hash') ? keys %$input : @$input) for my $element ( @$input) { my $isFilename = isaFilename($element); if ( $afterFirst ++ ) { defined addInterStream($obj, $element, $isFilename) or return $obj->closeError(undef) ; } else { $obj->getFileInfo($x->{Got}, $element) if $isFilename; $obj->_create($x->{Got}, @_) or return undef ; } defined $obj->_wr2($element, $isFilename) or return $obj->closeError(undef) ; *$obj->{Got} = $keep->clone(); } return $obj->close() ; } } sub _wr2 { my $self = shift ; my $source = shift ; my $inputIsFilename = shift; my $input = $source ; if (! $inputIsFilename) { $input = \$source if ! ref $source; } if ( ref $input && ref $input eq 'SCALAR' ) { return $self->syswrite($input, @_) ; } if ( ! ref $input || isaFilehandle($input)) { my $isFilehandle = isaFilehandle($input) ; my $fh = $input ; if ( ! $isFilehandle ) { $fh = new IO::File "<$input" or return $self->saveErrorString(undef, "cannot open file '$input': $!", $!) ; } binmode $fh if *$self->{Got}->valueOrDefault('BinModeIn') ; my $status ; my $buff ; my $count = 0 ; while ($status = read($fh, $buff, 16 * 1024)) { $count += length $buff; defined $self->syswrite($buff, @_) or return undef ; } return $self->saveErrorString(undef, $!, $!) if ! defined $status ; if ( (!$isFilehandle || *$self->{AutoClose}) && $input ne '-') { $fh->close() or return undef ; } return $count ; } croak "Should not be here"; return undef; } sub addInterStream { my $self = shift ; my $input = shift ; my $inputIsFilename = shift ; if (*$self->{Got}->value('MultiStream')) { $self->getFileInfo(*$self->{Got}, $input) #if isaFilename($input) and $inputIsFilename ; if isaFilename($input) ; # TODO -- newStream needs to allow gzip/zip header to be modified return $self->newStream(); } elsif (*$self->{Got}->value('AutoFlush')) { #return $self->flush(Z_FULL_FLUSH); } return 1 ; } sub getFileInfo { } sub TIEHANDLE { return $_[0] if ref($_[0]); die "OOPS\n" ; } sub UNTIE { my $self = shift ; } sub DESTROY { my $self = shift ; local ($., $@, $!, $^E, $?); $self->close() ; # TODO - memory leak with 5.8.0 - this isn't called until # global destruction # %{ *$self } = () ; undef $self ; } sub filterUncompressed { } sub syswrite { my $self = shift ; my $buffer ; if (ref $_[0] ) { $self->croakError( *$self->{ClassName} . "::write: not a scalar reference" ) unless ref $_[0] eq 'SCALAR' ; $buffer = $_[0] ; } else { $buffer = \$_[0] ; } $] >= 5.008 and ( utf8::downgrade($$buffer, 1) or croak "Wide character in " . *$self->{ClassName} . "::write:"); if (@_ > 1) { my $slen = defined $$buffer ? length($$buffer) : 0; my $len = $slen; my $offset = 0; $len = $_[1] if $_[1] < $len; if (@_ > 2) { $offset = $_[2] || 0; $self->croakError(*$self->{ClassName} . "::write: offset outside string") if $offset > $slen; if ($offset < 0) { $offset += $slen; $self->croakError( *$self->{ClassName} . "::write: offset outside string") if $offset < 0; } my $rem = $slen - $offset; $len = $rem if $rem < $len; } $buffer = \substr($$buffer, $offset, $len) ; } return 0 if ! defined $$buffer || length $$buffer == 0 ; if (*$self->{Encoding}) { $$buffer = *$self->{Encoding}->encode($$buffer); } $self->filterUncompressed($buffer); my $buffer_length = defined $$buffer ? length($$buffer) : 0 ; *$self->{UnCompSize}->add($buffer_length) ; my $outBuffer=''; my $status = *$self->{Compress}->compr($buffer, $outBuffer) ; return $self->saveErrorString(undef, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; *$self->{CompSize}->add(length $outBuffer) ; $self->output($outBuffer) or return undef; return $buffer_length; } sub print { my $self = shift; #if (ref $self) { # $self = *$self{GLOB} ; #} if (defined $\) { if (defined $,) { defined $self->syswrite(join($,, @_) . $\); } else { defined $self->syswrite(join("", @_) . $\); } } else { if (defined $,) { defined $self->syswrite(join($,, @_)); } else { defined $self->syswrite(join("", @_)); } } } sub printf { my $self = shift; my $fmt = shift; defined $self->syswrite(sprintf($fmt, @_)); } sub flush { my $self = shift ; my $outBuffer=''; my $status = *$self->{Compress}->flush($outBuffer, @_) ; return $self->saveErrorString(0, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; if ( defined *$self->{FH} ) { *$self->{FH}->clearerr(); } *$self->{CompSize}->add(length $outBuffer) ; $self->output($outBuffer) or return 0; if ( defined *$self->{FH} ) { defined *$self->{FH}->flush() or return $self->saveErrorString(0, $!, $!); } return 1; } sub newStream { my $self = shift ; $self->_writeTrailer() or return 0 ; my $got = $self->checkParams('newStream', *$self->{Got}, @_) or return 0 ; $self->ckParams($got) or $self->croakError("newStream: $self->{Error}"); *$self->{Compress} = $self->mkComp($got) or return 0; *$self->{Header} = $self->mkHeader($got) ; $self->output(*$self->{Header} ) or return 0; *$self->{UnCompSize}->reset(); *$self->{CompSize}->reset(); return 1 ; } sub reset { my $self = shift ; return *$self->{Compress}->reset() ; } sub _writeTrailer { my $self = shift ; my $trailer = ''; my $status = *$self->{Compress}->close($trailer) ; return $self->saveErrorString(0, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; *$self->{CompSize}->add(length $trailer) ; $trailer .= $self->mkTrailer(); defined $trailer or return 0; return $self->output($trailer); } sub _writeFinalTrailer { my $self = shift ; return $self->output($self->mkFinalTrailer()); } sub close { my $self = shift ; return 1 if *$self->{Closed} || ! *$self->{Compress} ; *$self->{Closed} = 1 ; untie *$self if $] >= 5.008 ; $self->_writeTrailer() or return 0 ; $self->_writeFinalTrailer() or return 0 ; $self->output( "", 1 ) or return 0; if (defined *$self->{FH}) { #if (! *$self->{Handle} || *$self->{AutoClose}) { if ((! *$self->{Handle} || *$self->{AutoClose}) && ! *$self->{StdIO}) { $! = 0 ; *$self->{FH}->close() or return $self->saveErrorString(0, $!, $!); } delete *$self->{FH} ; # This delete can set $! in older Perls, so reset the errno $! = 0 ; } return 1; } #sub total_in #sub total_out #sub msg # #sub crc #{ # my $self = shift ; # return *$self->{Compress}->crc32() ; #} # #sub msg #{ # my $self = shift ; # return *$self->{Compress}->msg() ; #} # #sub dict_adler #{ # my $self = shift ; # return *$self->{Compress}->dict_adler() ; #} # #sub get_Level #{ # my $self = shift ; # return *$self->{Compress}->get_Level() ; #} # #sub get_Strategy #{ # my $self = shift ; # return *$self->{Compress}->get_Strategy() ; #} sub tell { my $self = shift ; return *$self->{UnCompSize}->get32bit() ; } sub eof { my $self = shift ; return *$self->{Closed} ; } sub seek { my $self = shift ; my $position = shift; my $whence = shift ; my $here = $self->tell() ; my $target = 0 ; #use IO::Handle qw(SEEK_SET SEEK_CUR SEEK_END); use IO::Handle ; if ($whence == IO::Handle::SEEK_SET) { $target = $position ; } elsif ($whence == IO::Handle::SEEK_CUR || $whence == IO::Handle::SEEK_END) { $target = $here + $position ; } else { $self->croakError(*$self->{ClassName} . "::seek: unknown value, $whence, for whence parameter"); } # short circuit if seeking to current offset return 1 if $target == $here ; # Outlaw any attempt to seek backwards $self->croakError(*$self->{ClassName} . "::seek: cannot seek backwards") if $target < $here ; # Walk the file to the new offset my $offset = $target - $here ; my $buffer ; defined $self->syswrite("\x00" x $offset) or return 0; return 1 ; } sub binmode { 1; # my $self = shift ; # return defined *$self->{FH} # ? binmode *$self->{FH} # : 1 ; } sub fileno { my $self = shift ; return defined *$self->{FH} ? *$self->{FH}->fileno() : undef ; } sub opened { my $self = shift ; return ! *$self->{Closed} ; } sub autoflush { my $self = shift ; return defined *$self->{FH} ? *$self->{FH}->autoflush(@_) : undef ; } sub input_line_number { return undef ; } sub _notAvailable { my $name = shift ; return sub { croak "$name Not Available: File opened only for output" ; } ; } *read = _notAvailable('read'); *READ = _notAvailable('read'); *readline = _notAvailable('readline'); *READLINE = _notAvailable('readline'); *getc = _notAvailable('getc'); *GETC = _notAvailable('getc'); *FILENO = \&fileno; *PRINT = \&print; *PRINTF = \&printf; *WRITE = \&syswrite; *write = \&syswrite; *SEEK = \&seek; *TELL = \&tell; *EOF = \&eof; *CLOSE = \&close; *BINMODE = \&binmode; #*sysread = \&_notAvailable; #*syswrite = \&_write; 1; __END__ #line 982 FILE#c49d3089/IO/Compress/Base/Common.pmT#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Base/Common.pm" package IO::Compress::Base::Common; use strict ; use warnings; use bytes; use Carp; use Scalar::Util qw(blessed readonly); use File::GlobMapper; require Exporter; our ($VERSION, @ISA, @EXPORT, %EXPORT_TAGS, $HAS_ENCODE); @ISA = qw(Exporter); $VERSION = '2.024'; @EXPORT = qw( isaFilehandle isaFilename whatIsInput whatIsOutput isaFileGlobString cleanFileGlobString oneTarget setBinModeInput setBinModeOutput ckInOutParams createSelfTiedObject getEncoding WANT_CODE WANT_EXT WANT_UNDEF WANT_HASH STATUS_OK STATUS_ENDSTREAM STATUS_EOF STATUS_ERROR ); %EXPORT_TAGS = ( Status => [qw( STATUS_OK STATUS_ENDSTREAM STATUS_EOF STATUS_ERROR )]); use constant STATUS_OK => 0; use constant STATUS_ENDSTREAM => 1; use constant STATUS_EOF => 2; use constant STATUS_ERROR => -1; sub hasEncode() { if (! defined $HAS_ENCODE) { eval { require Encode; Encode->import(); }; $HAS_ENCODE = $@ ? 0 : 1 ; } return $HAS_ENCODE; } sub getEncoding($$$) { my $obj = shift; my $class = shift ; my $want_encoding = shift ; $obj->croakError("$class: Encode module needed to use -Encode") if ! hasEncode(); my $encoding = Encode::find_encoding($want_encoding); $obj->croakError("$class: Encoding '$want_encoding' is not available") if ! $encoding; return $encoding; } our ($needBinmode); $needBinmode = ($^O eq 'MSWin32' || ($] >= 5.006 && eval ' ${^UNICODE} || ${^UTF8LOCALE} ')) ? 1 : 1 ; sub setBinModeInput($) { my $handle = shift ; binmode $handle if $needBinmode; } sub setBinModeOutput($) { my $handle = shift ; binmode $handle if $needBinmode; } sub isaFilehandle($) { use utf8; # Pragma needed to keep Perl 5.6.0 happy return (defined $_[0] and (UNIVERSAL::isa($_[0],'GLOB') or UNIVERSAL::isa($_[0],'IO::Handle') or UNIVERSAL::isa(\$_[0],'GLOB')) ) } sub isaFilename($) { return (defined $_[0] and ! ref $_[0] and UNIVERSAL::isa(\$_[0], 'SCALAR')); } sub isaFileGlobString { return defined $_[0] && $_[0] =~ /^<.*>$/; } sub cleanFileGlobString { my $string = shift ; $string =~ s/^\s*<\s*(.*)\s*>\s*$/$1/; return $string; } use constant WANT_CODE => 1 ; use constant WANT_EXT => 2 ; use constant WANT_UNDEF => 4 ; #use constant WANT_HASH => 8 ; use constant WANT_HASH => 0 ; sub whatIsInput($;$) { my $got = whatIs(@_); if (defined $got && $got eq 'filename' && defined $_[0] && $_[0] eq '-') { #use IO::File; $got = 'handle'; $_[0] = *STDIN; #$_[0] = new IO::File("<-"); } return $got; } sub whatIsOutput($;$) { my $got = whatIs(@_); if (defined $got && $got eq 'filename' && defined $_[0] && $_[0] eq '-') { $got = 'handle'; $_[0] = *STDOUT; #$_[0] = new IO::File(">-"); } return $got; } sub whatIs ($;$) { return 'handle' if isaFilehandle($_[0]); my $wantCode = defined $_[1] && $_[1] & WANT_CODE ; my $extended = defined $_[1] && $_[1] & WANT_EXT ; my $undef = defined $_[1] && $_[1] & WANT_UNDEF ; my $hash = defined $_[1] && $_[1] & WANT_HASH ; return 'undef' if ! defined $_[0] && $undef ; if (ref $_[0]) { return '' if blessed($_[0]); # is an object #return '' if UNIVERSAL::isa($_[0], 'UNIVERSAL'); # is an object return 'buffer' if UNIVERSAL::isa($_[0], 'SCALAR'); return 'array' if UNIVERSAL::isa($_[0], 'ARRAY') && $extended ; return 'hash' if UNIVERSAL::isa($_[0], 'HASH') && $hash ; return 'code' if UNIVERSAL::isa($_[0], 'CODE') && $wantCode ; return ''; } return 'fileglob' if $extended && isaFileGlobString($_[0]); return 'filename'; } sub oneTarget { return $_[0] =~ /^(code|handle|buffer|filename)$/; } sub IO::Compress::Base::Validator::new { my $class = shift ; my $Class = shift ; my $error_ref = shift ; my $reportClass = shift ; my %data = (Class => $Class, Error => $error_ref, reportClass => $reportClass, ) ; my $obj = bless \%data, $class ; local $Carp::CarpLevel = 1; my $inType = $data{inType} = whatIsInput($_[0], WANT_EXT|WANT_HASH); my $outType = $data{outType} = whatIsOutput($_[1], WANT_EXT|WANT_HASH); my $oneInput = $data{oneInput} = oneTarget($inType); my $oneOutput = $data{oneOutput} = oneTarget($outType); if (! $inType) { $obj->croakError("$reportClass: illegal input parameter") ; #return undef ; } # if ($inType eq 'hash') # { # $obj->{Hash} = 1 ; # $obj->{oneInput} = 1 ; # return $obj->validateHash($_[0]); # } if (! $outType) { $obj->croakError("$reportClass: illegal output parameter") ; #return undef ; } if ($inType ne 'fileglob' && $outType eq 'fileglob') { $obj->croakError("Need input fileglob for outout fileglob"); } # if ($inType ne 'fileglob' && $outType eq 'hash' && $inType ne 'filename' ) # { # $obj->croakError("input must ne filename or fileglob when output is a hash"); # } if ($inType eq 'fileglob' && $outType eq 'fileglob') { $data{GlobMap} = 1 ; $data{inType} = $data{outType} = 'filename'; my $mapper = new File::GlobMapper($_[0], $_[1]); if ( ! $mapper ) { return $obj->saveErrorString($File::GlobMapper::Error) ; } $data{Pairs} = $mapper->getFileMap(); return $obj; } $obj->croakError("$reportClass: input and output $inType are identical") if $inType eq $outType && $_[0] eq $_[1] && $_[0] ne '-' ; if ($inType eq 'fileglob') # && $outType ne 'fileglob' { my $glob = cleanFileGlobString($_[0]); my @inputs = glob($glob); if (@inputs == 0) { # TODO -- legal or die? die "globmap matched zero file -- legal or die???" ; } elsif (@inputs == 1) { $obj->validateInputFilenames($inputs[0]) or return undef; $_[0] = $inputs[0] ; $data{inType} = 'filename' ; $data{oneInput} = 1; } else { $obj->validateInputFilenames(@inputs) or return undef; $_[0] = [ @inputs ] ; $data{inType} = 'filenames' ; } } elsif ($inType eq 'filename') { $obj->validateInputFilenames($_[0]) or return undef; } elsif ($inType eq 'array') { $data{inType} = 'filenames' ; $obj->validateInputArray($_[0]) or return undef ; } return $obj->saveErrorString("$reportClass: output buffer is read-only") if $outType eq 'buffer' && readonly(${ $_[1] }); if ($outType eq 'filename' ) { $obj->croakError("$reportClass: output filename is undef or null string") if ! defined $_[1] || $_[1] eq '' ; if (-e $_[1]) { if (-d _ ) { return $obj->saveErrorString("output file '$_[1]' is a directory"); } } } return $obj ; } sub IO::Compress::Base::Validator::saveErrorString { my $self = shift ; ${ $self->{Error} } = shift ; return undef; } sub IO::Compress::Base::Validator::croakError { my $self = shift ; $self->saveErrorString($_[0]); croak $_[0]; } sub IO::Compress::Base::Validator::validateInputFilenames { my $self = shift ; foreach my $filename (@_) { $self->croakError("$self->{reportClass}: input filename is undef or null string") if ! defined $filename || $filename eq '' ; next if $filename eq '-'; if (! -e $filename ) { return $self->saveErrorString("input file '$filename' does not exist"); } if (-d _ ) { return $self->saveErrorString("input file '$filename' is a directory"); } if (! -r _ ) { return $self->saveErrorString("cannot open file '$filename': $!"); } } return 1 ; } sub IO::Compress::Base::Validator::validateInputArray { my $self = shift ; if ( @{ $_[0] } == 0 ) { return $self->saveErrorString("empty array reference") ; } foreach my $element ( @{ $_[0] } ) { my $inType = whatIsInput($element); if (! $inType) { $self->croakError("unknown input parameter") ; } elsif($inType eq 'filename') { $self->validateInputFilenames($element) or return undef ; } else { $self->croakError("not a filename") ; } } return 1 ; } #sub IO::Compress::Base::Validator::validateHash #{ # my $self = shift ; # my $href = shift ; # # while (my($k, $v) = each %$href) # { # my $ktype = whatIsInput($k); # my $vtype = whatIsOutput($v, WANT_EXT|WANT_UNDEF) ; # # if ($ktype ne 'filename') # { # return $self->saveErrorString("hash key not filename") ; # } # # my %valid = map { $_ => 1 } qw(filename buffer array undef handle) ; # if (! $valid{$vtype}) # { # return $self->saveErrorString("hash value not ok") ; # } # } # # return $self ; #} sub createSelfTiedObject { my $class = shift || (caller)[0] ; my $error_ref = shift ; my $obj = bless Symbol::gensym(), ref($class) || $class; tie *$obj, $obj if $] >= 5.005; *$obj->{Closed} = 1 ; $$error_ref = ''; *$obj->{Error} = $error_ref ; my $errno = 0 ; *$obj->{ErrorNo} = \$errno ; return $obj; } #package Parse::Parameters ; # # #require Exporter; #our ($VERSION, @ISA, @EXPORT); #$VERSION = '2.000_08'; #@ISA = qw(Exporter); $EXPORT_TAGS{Parse} = [qw( ParseParameters Parse_any Parse_unsigned Parse_signed Parse_boolean Parse_custom Parse_string Parse_multiple Parse_writable_scalar ) ]; push @EXPORT, @{ $EXPORT_TAGS{Parse} } ; use constant Parse_any => 0x01; use constant Parse_unsigned => 0x02; use constant Parse_signed => 0x04; use constant Parse_boolean => 0x08; use constant Parse_string => 0x10; use constant Parse_custom => 0x12; #use constant Parse_store_ref => 0x100 ; use constant Parse_multiple => 0x100 ; use constant Parse_writable => 0x200 ; use constant Parse_writable_scalar => 0x400 | Parse_writable ; use constant OFF_PARSED => 0 ; use constant OFF_TYPE => 1 ; use constant OFF_DEFAULT => 2 ; use constant OFF_FIXED => 3 ; use constant OFF_FIRST_ONLY => 4 ; use constant OFF_STICKY => 5 ; sub ParseParameters { my $level = shift || 0 ; my $sub = (caller($level + 1))[3] ; local $Carp::CarpLevel = 1 ; return $_[1] if @_ == 2 && defined $_[1] && UNIVERSAL::isa($_[1], "IO::Compress::Base::Parameters"); my $p = new IO::Compress::Base::Parameters() ; $p->parse(@_) or croak "$sub: $p->{Error}" ; return $p; } #package IO::Compress::Base::Parameters; use strict; use warnings; use Carp; sub IO::Compress::Base::Parameters::new { my $class = shift ; my $obj = { Error => '', Got => {}, } ; #return bless $obj, ref($class) || $class || __PACKAGE__ ; return bless $obj, 'IO::Compress::Base::Parameters' ; } sub IO::Compress::Base::Parameters::setError { my $self = shift ; my $error = shift ; my $retval = @_ ? shift : undef ; $self->{Error} = $error ; return $retval; } #sub getError #{ # my $self = shift ; # return $self->{Error} ; #} sub IO::Compress::Base::Parameters::parse { my $self = shift ; my $default = shift ; my $got = $self->{Got} ; my $firstTime = keys %{ $got } == 0 ; my $other; my (@Bad) ; my @entered = () ; # Allow the options to be passed as a hash reference or # as the complete hash. if (@_ == 0) { @entered = () ; } elsif (@_ == 1) { my $href = $_[0] ; return $self->setError("Expected even number of parameters, got 1") if ! defined $href or ! ref $href or ref $href ne "HASH" ; foreach my $key (keys %$href) { push @entered, $key ; push @entered, \$href->{$key} ; } } else { my $count = @_; return $self->setError("Expected even number of parameters, got $count") if $count % 2 != 0 ; for my $i (0.. $count / 2 - 1) { if ($_[2 * $i] eq '__xxx__') { $other = $_[2 * $i + 1] ; } else { push @entered, $_[2 * $i] ; push @entered, \$_[2 * $i + 1] ; } } } while (my ($key, $v) = each %$default) { croak "need 4 params [@$v]" if @$v != 4 ; my ($first_only, $sticky, $type, $value) = @$v ; my $x ; $self->_checkType($key, \$value, $type, 0, \$x) or return undef ; $key = lc $key; if ($firstTime || ! $sticky) { $x = [] if $type & Parse_multiple; $got->{$key} = [0, $type, $value, $x, $first_only, $sticky] ; } $got->{$key}[OFF_PARSED] = 0 ; } my %parsed = (); if ($other) { for my $key (keys %$default) { my $canonkey = lc $key; if ($other->parsed($canonkey)) { my $value = $other->value($canonkey); #print "SET '$canonkey' to $value [$$value]\n"; ++ $parsed{$canonkey}; $got->{$canonkey}[OFF_PARSED] = 1; $got->{$canonkey}[OFF_DEFAULT] = $value; $got->{$canonkey}[OFF_FIXED] = $value; } } } for my $i (0.. @entered / 2 - 1) { my $key = $entered[2* $i] ; my $value = $entered[2* $i+1] ; #print "Key [$key] Value [$value]" ; #print defined $$value ? "[$$value]\n" : "[undef]\n"; $key =~ s/^-// ; my $canonkey = lc $key; if ($got->{$canonkey} && ($firstTime || ! $got->{$canonkey}[OFF_FIRST_ONLY] )) { my $type = $got->{$canonkey}[OFF_TYPE] ; my $parsed = $parsed{$canonkey}; ++ $parsed{$canonkey}; return $self->setError("Muliple instances of '$key' found") if $parsed && $type & Parse_multiple == 0 ; my $s ; $self->_checkType($key, $value, $type, 1, \$s) or return undef ; $value = $$value ; if ($type & Parse_multiple) { $got->{$canonkey}[OFF_PARSED] = 1; push @{ $got->{$canonkey}[OFF_FIXED] }, $s ; } else { $got->{$canonkey} = [1, $type, $value, $s] ; } } else { push (@Bad, $key) } } if (@Bad) { my ($bad) = join(", ", @Bad) ; return $self->setError("unknown key value(s) $bad") ; } return 1; } sub IO::Compress::Base::Parameters::_checkType { my $self = shift ; my $key = shift ; my $value = shift ; my $type = shift ; my $validate = shift ; my $output = shift; #local $Carp::CarpLevel = $level ; #print "PARSE $type $key $value $validate $sub\n" ; if ($type & Parse_writable_scalar) { return $self->setError("Parameter '$key' not writable") if $validate && readonly $$value ; if (ref $$value) { return $self->setError("Parameter '$key' not a scalar reference") if $validate && ref $$value ne 'SCALAR' ; $$output = $$value ; } else { return $self->setError("Parameter '$key' not a scalar") if $validate && ref $value ne 'SCALAR' ; $$output = $value ; } return 1; } # if ($type & Parse_store_ref) # { # #$value = $$value # # if ref ${ $value } ; # # $$output = $value ; # return 1; # } $value = $$value ; if ($type & Parse_any) { $$output = $value ; return 1; } elsif ($type & Parse_unsigned) { return $self->setError("Parameter '$key' must be an unsigned int, got 'undef'") if $validate && ! defined $value ; return $self->setError("Parameter '$key' must be an unsigned int, got '$value'") if $validate && $value !~ /^\d+$/; $$output = defined $value ? $value : 0 ; return 1; } elsif ($type & Parse_signed) { return $self->setError("Parameter '$key' must be a signed int, got 'undef'") if $validate && ! defined $value ; return $self->setError("Parameter '$key' must be a signed int, got '$value'") if $validate && $value !~ /^-?\d+$/; $$output = defined $value ? $value : 0 ; return 1 ; } elsif ($type & Parse_boolean) { return $self->setError("Parameter '$key' must be an int, got '$value'") if $validate && defined $value && $value !~ /^\d*$/; $$output = defined $value ? $value != 0 : 0 ; return 1; } elsif ($type & Parse_string) { $$output = defined $value ? $value : "" ; return 1; } $$output = $value ; return 1; } sub IO::Compress::Base::Parameters::parsed { my $self = shift ; my $name = shift ; return $self->{Got}{lc $name}[OFF_PARSED] ; } sub IO::Compress::Base::Parameters::value { my $self = shift ; my $name = shift ; if (@_) { $self->{Got}{lc $name}[OFF_PARSED] = 1; $self->{Got}{lc $name}[OFF_DEFAULT] = $_[0] ; $self->{Got}{lc $name}[OFF_FIXED] = $_[0] ; } return $self->{Got}{lc $name}[OFF_FIXED] ; } sub IO::Compress::Base::Parameters::valueOrDefault { my $self = shift ; my $name = shift ; my $default = shift ; my $value = $self->{Got}{lc $name}[OFF_DEFAULT] ; return $value if defined $value ; return $default ; } sub IO::Compress::Base::Parameters::wantValue { my $self = shift ; my $name = shift ; return defined $self->{Got}{lc $name}[OFF_DEFAULT] ; } sub IO::Compress::Base::Parameters::clone { my $self = shift ; my $obj = { }; my %got ; while (my ($k, $v) = each %{ $self->{Got} }) { $got{$k} = [ @$v ]; } $obj->{Error} = $self->{Error}; $obj->{Got} = \%got ; return bless $obj, 'IO::Compress::Base::Parameters' ; } package U64; use constant MAX32 => 0xFFFFFFFF ; use constant HI_1 => MAX32 + 1 ; use constant LOW => 0 ; use constant HIGH => 1; sub new { my $class = shift ; my $high = 0 ; my $low = 0 ; if (@_ == 2) { $high = shift ; $low = shift ; } elsif (@_ == 1) { $low = shift ; } bless [$low, $high], $class; } sub newUnpack_V64 { my $string = shift; my ($low, $hi) = unpack "V V", $string ; bless [ $low, $hi ], "U64"; } sub newUnpack_V32 { my $string = shift; my $low = unpack "V", $string ; bless [ $low, 0 ], "U64"; } sub reset { my $self = shift; $self->[HIGH] = $self->[LOW] = 0; } sub clone { my $self = shift; bless [ @$self ], ref $self ; } sub getHigh { my $self = shift; return $self->[HIGH]; } sub getLow { my $self = shift; return $self->[LOW]; } sub get32bit { my $self = shift; return $self->[LOW]; } sub get64bit { my $self = shift; # Not using << here because the result will still be # a 32-bit value on systems where int size is 32-bits return $self->[HIGH] * HI_1 + $self->[LOW]; } sub add { my $self = shift; my $value = shift; if (ref $value eq 'U64') { $self->[HIGH] += $value->[HIGH] ; $value = $value->[LOW]; } my $available = MAX32 - $self->[LOW] ; if ($value > $available) { ++ $self->[HIGH] ; $self->[LOW] = $value - $available - 1; } else { $self->[LOW] += $value ; } } sub equal { my $self = shift; my $other = shift; return $self->[LOW] == $other->[LOW] && $self->[HIGH] == $other->[HIGH] ; } sub is64bit { my $self = shift; return $self->[HIGH] > 0 ; } sub getPacked_V64 { my $self = shift; return pack "V V", @$self ; } sub getPacked_V32 { my $self = shift; return pack "V", $self->[LOW] ; } sub pack_V64 { my $low = shift; return pack "V V", $low, 0; } package IO::Compress::Base::Common; 1; FILEd47b6636/IO/Compress/Gzip.pm#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Gzip.pm" package IO::Compress::Gzip ; require 5.004 ; use strict ; use warnings; use bytes; use IO::Compress::RawDeflate 2.024 ; use Compress::Raw::Zlib 2.024 ; use IO::Compress::Base::Common 2.024 qw(:Status :Parse createSelfTiedObject); use IO::Compress::Gzip::Constants 2.024 ; use IO::Compress::Zlib::Extra 2.024 ; BEGIN { if (defined &utf8::downgrade ) { *noUTF8 = \&utf8::downgrade } else { *noUTF8 = sub {} } } require Exporter ; our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS, $GzipError); $VERSION = '2.024'; $GzipError = '' ; @ISA = qw(Exporter IO::Compress::RawDeflate); @EXPORT_OK = qw( $GzipError gzip ) ; %EXPORT_TAGS = %IO::Compress::RawDeflate::DEFLATE_CONSTANTS ; push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; Exporter::export_ok_tags('all'); sub new { my $class = shift ; my $obj = createSelfTiedObject($class, \$GzipError); $obj->_create(undef, @_); } sub gzip { my $obj = createSelfTiedObject(undef, \$GzipError); return $obj->_def(@_); } #sub newHeader #{ # my $self = shift ; # #return GZIP_MINIMUM_HEADER ; # return $self->mkHeader(*$self->{Got}); #} sub getExtraParams { my $self = shift ; return ( # zlib behaviour $self->getZlibParams(), # Gzip header fields 'Minimal' => [0, 1, Parse_boolean, 0], 'Comment' => [0, 1, Parse_any, undef], 'Name' => [0, 1, Parse_any, undef], 'Time' => [0, 1, Parse_any, undef], 'TextFlag' => [0, 1, Parse_boolean, 0], 'HeaderCRC' => [0, 1, Parse_boolean, 0], 'OS_Code' => [0, 1, Parse_unsigned, $Compress::Raw::Zlib::gzip_os_code], 'ExtraField'=> [0, 1, Parse_any, undef], 'ExtraFlags'=> [0, 1, Parse_any, undef], ); } sub ckParams { my $self = shift ; my $got = shift ; # gzip always needs crc32 $got->value('CRC32' => 1); return 1 if $got->value('Merge') ; my $strict = $got->value('Strict') ; { if (! $got->parsed('Time') ) { # Modification time defaults to now. $got->value('Time' => time) ; } # Check that the Name & Comment don't have embedded NULLs # Also check that they only contain ISO 8859-1 chars. if ($got->parsed('Name') && defined $got->value('Name')) { my $name = $got->value('Name'); return $self->saveErrorString(undef, "Null Character found in Name", Z_DATA_ERROR) if $strict && $name =~ /\x00/ ; return $self->saveErrorString(undef, "Non ISO 8859-1 Character found in Name", Z_DATA_ERROR) if $strict && $name =~ /$GZIP_FNAME_INVALID_CHAR_RE/o ; } if ($got->parsed('Comment') && defined $got->value('Comment')) { my $comment = $got->value('Comment'); return $self->saveErrorString(undef, "Null Character found in Comment", Z_DATA_ERROR) if $strict && $comment =~ /\x00/ ; return $self->saveErrorString(undef, "Non ISO 8859-1 Character found in Comment", Z_DATA_ERROR) if $strict && $comment =~ /$GZIP_FCOMMENT_INVALID_CHAR_RE/o; } if ($got->parsed('OS_Code') ) { my $value = $got->value('OS_Code'); return $self->saveErrorString(undef, "OS_Code must be between 0 and 255, got '$value'") if $value < 0 || $value > 255 ; } # gzip only supports Deflate at present $got->value('Method' => Z_DEFLATED) ; if ( ! $got->parsed('ExtraFlags')) { $got->value('ExtraFlags' => 2) if $got->value('Level') == Z_BEST_SPEED ; $got->value('ExtraFlags' => 4) if $got->value('Level') == Z_BEST_COMPRESSION ; } my $data = $got->value('ExtraField') ; if (defined $data) { my $bad = IO::Compress::Zlib::Extra::parseExtraField($data, $strict, 1) ; return $self->saveErrorString(undef, "Error with ExtraField Parameter: $bad", Z_DATA_ERROR) if $bad ; $got->value('ExtraField', $data) ; } } return 1; } sub mkTrailer { my $self = shift ; return pack("V V", *$self->{Compress}->crc32(), *$self->{UnCompSize}->get32bit()); } sub getInverseClass { return ('IO::Uncompress::Gunzip', \$IO::Uncompress::Gunzip::GunzipError); } sub getFileInfo { my $self = shift ; my $params = shift; my $filename = shift ; my $defaultTime = (stat($filename))[9] ; $params->value('Name' => $filename) if ! $params->parsed('Name') ; $params->value('Time' => $defaultTime) if ! $params->parsed('Time') ; } sub mkHeader { my $self = shift ; my $param = shift ; # stort-circuit if a minimal header is requested. return GZIP_MINIMUM_HEADER if $param->value('Minimal') ; # METHOD my $method = $param->valueOrDefault('Method', GZIP_CM_DEFLATED) ; # FLAGS my $flags = GZIP_FLG_DEFAULT ; $flags |= GZIP_FLG_FTEXT if $param->value('TextFlag') ; $flags |= GZIP_FLG_FHCRC if $param->value('HeaderCRC') ; $flags |= GZIP_FLG_FEXTRA if $param->wantValue('ExtraField') ; $flags |= GZIP_FLG_FNAME if $param->wantValue('Name') ; $flags |= GZIP_FLG_FCOMMENT if $param->wantValue('Comment') ; # MTIME my $time = $param->valueOrDefault('Time', GZIP_MTIME_DEFAULT) ; # EXTRA FLAGS my $extra_flags = $param->valueOrDefault('ExtraFlags', GZIP_XFL_DEFAULT); # OS CODE my $os_code = $param->valueOrDefault('OS_Code', GZIP_OS_DEFAULT) ; my $out = pack("C4 V C C", GZIP_ID1, # ID1 GZIP_ID2, # ID2 $method, # Compression Method $flags, # Flags $time, # Modification Time $extra_flags, # Extra Flags $os_code, # Operating System Code ) ; # EXTRA if ($flags & GZIP_FLG_FEXTRA) { my $extra = $param->value('ExtraField') ; $out .= pack("v", length $extra) . $extra ; } # NAME if ($flags & GZIP_FLG_FNAME) { my $name .= $param->value('Name') ; $name =~ s/\x00.*$//; $out .= $name ; # Terminate the filename with NULL unless it already is $out .= GZIP_NULL_BYTE if !length $name or substr($name, 1, -1) ne GZIP_NULL_BYTE ; } # COMMENT if ($flags & GZIP_FLG_FCOMMENT) { my $comment .= $param->value('Comment') ; $comment =~ s/\x00.*$//; $out .= $comment ; # Terminate the comment with NULL unless it already is $out .= GZIP_NULL_BYTE if ! length $comment or substr($comment, 1, -1) ne GZIP_NULL_BYTE; } # HEADER CRC $out .= pack("v", crc32($out) & 0x00FF ) if $param->value('HeaderCRC') ; noUTF8($out); return $out ; } sub mkFinalTrailer { return ''; } 1; __END__ #line 1243 FILE&820cea4d/IO/Compress/Gzip/Constants.pm}#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Gzip/Constants.pm" package IO::Compress::Gzip::Constants; use strict ; use warnings; use bytes; require Exporter; our ($VERSION, @ISA, @EXPORT, %GZIP_OS_Names); our ($GZIP_FNAME_INVALID_CHAR_RE, $GZIP_FCOMMENT_INVALID_CHAR_RE); $VERSION = '2.024'; @ISA = qw(Exporter); @EXPORT= qw( GZIP_ID_SIZE GZIP_ID1 GZIP_ID2 GZIP_FLG_DEFAULT GZIP_FLG_FTEXT GZIP_FLG_FHCRC GZIP_FLG_FEXTRA GZIP_FLG_FNAME GZIP_FLG_FCOMMENT GZIP_FLG_RESERVED GZIP_CM_DEFLATED GZIP_MIN_HEADER_SIZE GZIP_TRAILER_SIZE GZIP_MTIME_DEFAULT GZIP_XFL_DEFAULT GZIP_FEXTRA_HEADER_SIZE GZIP_FEXTRA_MAX_SIZE GZIP_FEXTRA_SUBFIELD_HEADER_SIZE GZIP_FEXTRA_SUBFIELD_ID_SIZE GZIP_FEXTRA_SUBFIELD_LEN_SIZE GZIP_FEXTRA_SUBFIELD_MAX_SIZE $GZIP_FNAME_INVALID_CHAR_RE $GZIP_FCOMMENT_INVALID_CHAR_RE GZIP_FHCRC_SIZE GZIP_ISIZE_MAX GZIP_ISIZE_MOD_VALUE GZIP_NULL_BYTE GZIP_OS_DEFAULT %GZIP_OS_Names GZIP_MINIMUM_HEADER ); # Constant names derived from RFC 1952 use constant GZIP_ID_SIZE => 2 ; use constant GZIP_ID1 => 0x1F; use constant GZIP_ID2 => 0x8B; use constant GZIP_MIN_HEADER_SIZE => 10 ;# minimum gzip header size use constant GZIP_TRAILER_SIZE => 8 ; use constant GZIP_FLG_DEFAULT => 0x00 ; use constant GZIP_FLG_FTEXT => 0x01 ; use constant GZIP_FLG_FHCRC => 0x02 ; # called CONTINUATION in gzip use constant GZIP_FLG_FEXTRA => 0x04 ; use constant GZIP_FLG_FNAME => 0x08 ; use constant GZIP_FLG_FCOMMENT => 0x10 ; #use constant GZIP_FLG_ENCRYPTED => 0x20 ; # documented in gzip sources use constant GZIP_FLG_RESERVED => (0x20 | 0x40 | 0x80) ; use constant GZIP_XFL_DEFAULT => 0x00 ; use constant GZIP_MTIME_DEFAULT => 0x00 ; use constant GZIP_FEXTRA_HEADER_SIZE => 2 ; use constant GZIP_FEXTRA_MAX_SIZE => 0xFFFF ; use constant GZIP_FEXTRA_SUBFIELD_ID_SIZE => 2 ; use constant GZIP_FEXTRA_SUBFIELD_LEN_SIZE => 2 ; use constant GZIP_FEXTRA_SUBFIELD_HEADER_SIZE => GZIP_FEXTRA_SUBFIELD_ID_SIZE + GZIP_FEXTRA_SUBFIELD_LEN_SIZE; use constant GZIP_FEXTRA_SUBFIELD_MAX_SIZE => GZIP_FEXTRA_MAX_SIZE - GZIP_FEXTRA_SUBFIELD_HEADER_SIZE ; if (ord('A') == 193) { # EBCDIC $GZIP_FNAME_INVALID_CHAR_RE = '[\x00-\x3f\xff]'; $GZIP_FCOMMENT_INVALID_CHAR_RE = '[\x00-\x0a\x11-\x14\x16-\x3f\xff]'; } else { $GZIP_FNAME_INVALID_CHAR_RE = '[\x00-\x1F\x7F-\x9F]'; $GZIP_FCOMMENT_INVALID_CHAR_RE = '[\x00-\x09\x11-\x1F\x7F-\x9F]'; } use constant GZIP_FHCRC_SIZE => 2 ; # aka CONTINUATION in gzip use constant GZIP_CM_DEFLATED => 8 ; use constant GZIP_NULL_BYTE => "\x00"; use constant GZIP_ISIZE_MAX => 0xFFFFFFFF ; use constant GZIP_ISIZE_MOD_VALUE => GZIP_ISIZE_MAX + 1 ; # OS Names sourced from http://www.gzip.org/format.txt use constant GZIP_OS_DEFAULT=> 0xFF ; %GZIP_OS_Names = ( 0 => 'MS-DOS', 1 => 'Amiga', 2 => 'VMS', 3 => 'Unix', 4 => 'VM/CMS', 5 => 'Atari TOS', 6 => 'HPFS (OS/2, NT)', 7 => 'Macintosh', 8 => 'Z-System', 9 => 'CP/M', 10 => 'TOPS-20', 11 => 'NTFS (NT)', 12 => 'SMS QDOS', 13 => 'Acorn RISCOS', 14 => 'VFAT file system (Win95, NT)', 15 => 'MVS', 16 => 'BeOS', 17 => 'Tandem/NSK', 18 => 'THEOS', GZIP_OS_DEFAULT() => 'Unknown', ) ; use constant GZIP_MINIMUM_HEADER => pack("C4 V C C", GZIP_ID1, GZIP_ID2, GZIP_CM_DEFLATED, GZIP_FLG_DEFAULT, GZIP_MTIME_DEFAULT, GZIP_XFL_DEFAULT, GZIP_OS_DEFAULT) ; 1; FILE"b1e2cc6e/IO/Compress/RawDeflate.pms#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/RawDeflate.pm" package IO::Compress::RawDeflate ; # create RFC1951 # use strict ; use warnings; use bytes; use IO::Compress::Base 2.024 ; use IO::Compress::Base::Common 2.024 qw(:Status createSelfTiedObject); use IO::Compress::Adapter::Deflate 2.024 ; require Exporter ; our ($VERSION, @ISA, @EXPORT_OK, %DEFLATE_CONSTANTS, %EXPORT_TAGS, $RawDeflateError); $VERSION = '2.024'; $RawDeflateError = ''; @ISA = qw(Exporter IO::Compress::Base); @EXPORT_OK = qw( $RawDeflateError rawdeflate ) ; %EXPORT_TAGS = ( flush => [qw{ Z_NO_FLUSH Z_PARTIAL_FLUSH Z_SYNC_FLUSH Z_FULL_FLUSH Z_FINISH Z_BLOCK }], level => [qw{ Z_NO_COMPRESSION Z_BEST_SPEED Z_BEST_COMPRESSION Z_DEFAULT_COMPRESSION }], strategy => [qw{ Z_FILTERED Z_HUFFMAN_ONLY Z_RLE Z_FIXED Z_DEFAULT_STRATEGY }], ); { my %seen; foreach (keys %EXPORT_TAGS ) { push @{$EXPORT_TAGS{constants}}, grep { !$seen{$_}++ } @{ $EXPORT_TAGS{$_} } } $EXPORT_TAGS{all} = $EXPORT_TAGS{constants} ; } %DEFLATE_CONSTANTS = %EXPORT_TAGS; push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; Exporter::export_ok_tags('all'); sub new { my $class = shift ; my $obj = createSelfTiedObject($class, \$RawDeflateError); return $obj->_create(undef, @_); } sub rawdeflate { my $obj = createSelfTiedObject(undef, \$RawDeflateError); return $obj->_def(@_); } sub ckParams { my $self = shift ; my $got = shift; return 1 ; } sub mkComp { my $self = shift ; my $got = shift ; my ($obj, $errstr, $errno) = IO::Compress::Adapter::Deflate::mkCompObject( $got->value('CRC32'), $got->value('Adler32'), $got->value('Level'), $got->value('Strategy') ); return $self->saveErrorString(undef, $errstr, $errno) if ! defined $obj; return $obj; } sub mkHeader { my $self = shift ; return ''; } sub mkTrailer { my $self = shift ; return ''; } sub mkFinalTrailer { return ''; } #sub newHeader #{ # my $self = shift ; # return ''; #} sub getExtraParams { my $self = shift ; return $self->getZlibParams(); } sub getZlibParams { my $self = shift ; use IO::Compress::Base::Common 2.024 qw(:Parse); use Compress::Raw::Zlib 2.024 qw(Z_DEFLATED Z_DEFAULT_COMPRESSION Z_DEFAULT_STRATEGY); return ( # zlib behaviour #'Method' => [0, 1, Parse_unsigned, Z_DEFLATED], 'Level' => [0, 1, Parse_signed, Z_DEFAULT_COMPRESSION], 'Strategy' => [0, 1, Parse_signed, Z_DEFAULT_STRATEGY], 'CRC32' => [0, 1, Parse_boolean, 0], 'ADLER32' => [0, 1, Parse_boolean, 0], 'Merge' => [1, 1, Parse_boolean, 0], ); } sub getInverseClass { return ('IO::Uncompress::RawInflate', \$IO::Uncompress::RawInflate::RawInflateError); } sub getFileInfo { my $self = shift ; my $params = shift; my $file = shift ; } use IO::Seekable qw(SEEK_SET); sub createMerge { my $self = shift ; my $outValue = shift ; my $outType = shift ; my ($invClass, $error_ref) = $self->getInverseClass(); eval "require $invClass" or die "aaaahhhh" ; my $inf = $invClass->new( $outValue, Transparent => 0, #Strict => 1, AutoClose => 0, Scan => 1) or return $self->saveErrorString(undef, "Cannot create InflateScan object: $$error_ref" ) ; my $end_offset = 0; $inf->scan() or return $self->saveErrorString(undef, "Error Scanning: $$error_ref", $inf->errorNo) ; $inf->zap($end_offset) or return $self->saveErrorString(undef, "Error Zapping: $$error_ref", $inf->errorNo) ; my $def = *$self->{Compress} = $inf->createDeflate(); *$self->{Header} = *$inf->{Info}{Header}; *$self->{UnCompSize} = *$inf->{UnCompSize}->clone(); *$self->{CompSize} = *$inf->{CompSize}->clone(); # TODO -- fix this #*$self->{CompSize} = new U64(0, *$self->{UnCompSize_32bit}); if ( $outType eq 'buffer') { substr( ${ *$self->{Buffer} }, $end_offset) = '' } elsif ($outType eq 'handle' || $outType eq 'filename') { *$self->{FH} = *$inf->{FH} ; delete *$inf->{FH}; *$self->{FH}->flush() ; *$self->{Handle} = 1 if $outType eq 'handle'; #seek(*$self->{FH}, $end_offset, SEEK_SET) *$self->{FH}->seek($end_offset, SEEK_SET) or return $self->saveErrorString(undef, $!, $!) ; } return $def ; } #### zlib specific methods sub deflateParams { my $self = shift ; my $level = shift ; my $strategy = shift ; my $status = *$self->{Compress}->deflateParams(Level => $level, Strategy => $strategy) ; return $self->saveErrorString(0, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; return 1; } 1; __END__ #line 1018 FILE"4f0bc9d4/IO/Compress/Zlib/Extra.pm#line 1 "/usr/lib/perl5/5.12.2/IO/Compress/Zlib/Extra.pm" package IO::Compress::Zlib::Extra; require 5.004 ; use strict ; use warnings; use bytes; our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS); $VERSION = '2.024'; use IO::Compress::Gzip::Constants 2.024 ; sub ExtraFieldError { return $_[0]; return "Error with ExtraField Parameter: $_[0]" ; } sub validateExtraFieldPair { my $pair = shift ; my $strict = shift; my $gzipMode = shift ; return ExtraFieldError("Not an array ref") unless ref $pair && ref $pair eq 'ARRAY'; return ExtraFieldError("SubField must have two parts") unless @$pair == 2 ; return ExtraFieldError("SubField ID is a reference") if ref $pair->[0] ; return ExtraFieldError("SubField Data is a reference") if ref $pair->[1] ; # ID is exactly two chars return ExtraFieldError("SubField ID not two chars long") unless length $pair->[0] == GZIP_FEXTRA_SUBFIELD_ID_SIZE ; # Check that the 2nd byte of the ID isn't 0 return ExtraFieldError("SubField ID 2nd byte is 0x00") if $strict && $gzipMode && substr($pair->[0], 1, 1) eq "\x00" ; return ExtraFieldError("SubField Data too long") if length $pair->[1] > GZIP_FEXTRA_SUBFIELD_MAX_SIZE ; return undef ; } sub parseRawExtra { my $data = shift ; my $extraRef = shift; my $strict = shift; my $gzipMode = shift ; #my $lax = shift ; #return undef # if $lax ; my $XLEN = length $data ; return ExtraFieldError("Too Large") if $XLEN > GZIP_FEXTRA_MAX_SIZE; my $offset = 0 ; while ($offset < $XLEN) { return ExtraFieldError("Truncated in FEXTRA Body Section") if $offset + GZIP_FEXTRA_SUBFIELD_HEADER_SIZE > $XLEN ; my $id = substr($data, $offset, GZIP_FEXTRA_SUBFIELD_ID_SIZE); $offset += GZIP_FEXTRA_SUBFIELD_ID_SIZE; my $subLen = unpack("v", substr($data, $offset, GZIP_FEXTRA_SUBFIELD_LEN_SIZE)); $offset += GZIP_FEXTRA_SUBFIELD_LEN_SIZE ; return ExtraFieldError("Truncated in FEXTRA Body Section") if $offset + $subLen > $XLEN ; my $bad = validateExtraFieldPair( [$id, substr($data, $offset, $subLen)], $strict, $gzipMode ); return $bad if $bad ; push @$extraRef, [$id => substr($data, $offset, $subLen)] if defined $extraRef;; $offset += $subLen ; } return undef ; } sub mkSubField { my $id = shift ; my $data = shift ; return $id . pack("v", length $data) . $data ; } sub parseExtraField { my $dataRef = $_[0]; my $strict = $_[1]; my $gzipMode = $_[2]; #my $lax = @_ == 2 ? $_[1] : 1; # ExtraField can be any of # # -ExtraField => $data # # -ExtraField => [$id1, $data1, # $id2, $data2] # ... # ] # # -ExtraField => [ [$id1 => $data1], # [$id2 => $data2], # ... # ] # # -ExtraField => { $id1 => $data1, # $id2 => $data2, # ... # } if ( ! ref $dataRef ) { return undef if ! $strict; return parseRawExtra($dataRef, undef, 1, $gzipMode); } #my $data = $$dataRef; my $data = $dataRef; my $out = '' ; if (ref $data eq 'ARRAY') { if (ref $data->[0]) { foreach my $pair (@$data) { return ExtraFieldError("Not list of lists") unless ref $pair eq 'ARRAY' ; my $bad = validateExtraFieldPair($pair, $strict, $gzipMode) ; return $bad if $bad ; $out .= mkSubField(@$pair); } } else { return ExtraFieldError("Not even number of elements") unless @$data % 2 == 0; for (my $ix = 0; $ix <= length(@$data) -1 ; $ix += 2) { my $bad = validateExtraFieldPair([$data->[$ix], $data->[$ix+1]], $strict, $gzipMode) ; return $bad if $bad ; $out .= mkSubField($data->[$ix], $data->[$ix+1]); } } } elsif (ref $data eq 'HASH') { while (my ($id, $info) = each %$data) { my $bad = validateExtraFieldPair([$id, $info], $strict, $gzipMode); return $bad if $bad ; $out .= mkSubField($id, $info); } } else { return ExtraFieldError("Not a scalar, array ref or hash ref") ; } return ExtraFieldError("Too Large") if length $out > GZIP_FEXTRA_MAX_SIZE; $_[0] = $out ; return undef; } 1; __END__ FILE)92c7112d/IO/Uncompress/Adapter/Inflate.pm #line 1 "/usr/lib/perl5/5.12.2/IO/Uncompress/Adapter/Inflate.pm" package IO::Uncompress::Adapter::Inflate; use strict; use warnings; use bytes; use IO::Compress::Base::Common 2.024 qw(:Status); use Compress::Raw::Zlib 2.024 qw(Z_OK Z_BUF_ERROR Z_STREAM_END Z_FINISH MAX_WBITS); our ($VERSION); $VERSION = '2.024'; sub mkUncompObject { my $crc32 = shift || 1; my $adler32 = shift || 1; my $scan = shift || 0; my $inflate ; my $status ; if ($scan) { ($inflate, $status) = new Compress::Raw::Zlib::InflateScan #LimitOutput => 1, CRC32 => $crc32, ADLER32 => $adler32, WindowBits => - MAX_WBITS ; } else { ($inflate, $status) = new Compress::Raw::Zlib::Inflate AppendOutput => 1, LimitOutput => 1, CRC32 => $crc32, ADLER32 => $adler32, WindowBits => - MAX_WBITS ; } return (undef, "Could not create Inflation object: $status", $status) if $status != Z_OK ; return bless {'Inf' => $inflate, 'CompSize' => 0, 'UnCompSize' => 0, 'Error' => '', 'ConsumesInput' => 1, } ; } sub uncompr { my $self = shift ; my $from = shift ; my $to = shift ; my $eof = shift ; my $inf = $self->{Inf}; my $status = $inf->inflate($from, $to, $eof); $self->{ErrorNo} = $status; if ($status != Z_OK && $status != Z_STREAM_END && $status != Z_BUF_ERROR) { $self->{Error} = "Inflation Error: $status"; return STATUS_ERROR; } return STATUS_OK if $status == Z_BUF_ERROR ; # ??? return STATUS_OK if $status == Z_OK ; return STATUS_ENDSTREAM if $status == Z_STREAM_END ; return STATUS_ERROR ; } sub reset { my $self = shift ; $self->{Inf}->inflateReset(); return STATUS_OK ; } #sub count #{ # my $self = shift ; # $self->{Inf}->inflateCount(); #} sub crc32 { my $self = shift ; $self->{Inf}->crc32(); } sub compressedBytes { my $self = shift ; $self->{Inf}->compressedBytes(); } sub uncompressedBytes { my $self = shift ; $self->{Inf}->uncompressedBytes(); } sub adler32 { my $self = shift ; $self->{Inf}->adler32(); } sub sync { my $self = shift ; ( $self->{Inf}->inflateSync(@_) == Z_OK) ? STATUS_OK : STATUS_ERROR ; } sub getLastBlockOffset { my $self = shift ; $self->{Inf}->getLastBlockOffset(); } sub getEndOffset { my $self = shift ; $self->{Inf}->getEndOffset(); } sub resetLastBlockByte { my $self = shift ; $self->{Inf}->resetLastBlockByte(@_); } sub createDeflateStream { my $self = shift ; my $deflate = $self->{Inf}->createDeflateStream(@_); return bless {'Def' => $deflate, 'CompSize' => 0, 'UnCompSize' => 0, 'Error' => '', }, 'IO::Compress::Adapter::Deflate'; } 1; __END__ FILE50039013/IO/Uncompress/Base.pm#line 1 "/usr/lib/perl5/5.12.2/IO/Uncompress/Base.pm" package IO::Uncompress::Base ; use strict ; use warnings; use bytes; our (@ISA, $VERSION, @EXPORT_OK, %EXPORT_TAGS); @ISA = qw(Exporter IO::File); $VERSION = '2.024'; use constant G_EOF => 0 ; use constant G_ERR => -1 ; use IO::Compress::Base::Common 2.024 ; #use Parse::Parameters ; use IO::File ; use Symbol; use Scalar::Util qw(readonly); use List::Util qw(min); use Carp ; %EXPORT_TAGS = ( ); push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; #Exporter::export_ok_tags('all') ; sub smartRead { my $self = $_[0]; my $out = $_[1]; my $size = $_[2]; $$out = "" ; my $offset = 0 ; if (defined *$self->{InputLength}) { return 0 if *$self->{InputLengthRemaining} <= 0 ; $size = min($size, *$self->{InputLengthRemaining}); } if ( length *$self->{Prime} ) { #$$out = substr(*$self->{Prime}, 0, $size, '') ; $$out = substr(*$self->{Prime}, 0, $size) ; substr(*$self->{Prime}, 0, $size) = '' ; if (length $$out == $size) { *$self->{InputLengthRemaining} -= length $$out if defined *$self->{InputLength}; return length $$out ; } $offset = length $$out ; } my $get_size = $size - $offset ; if (defined *$self->{FH}) { if ($offset) { # Not using this # # *$self->{FH}->read($$out, $get_size, $offset); # # because the filehandle may not support the offset parameter # An example is Net::FTP my $tmp = ''; *$self->{FH}->read($tmp, $get_size) && (substr($$out, $offset) = $tmp); } else { *$self->{FH}->read($$out, $get_size) } } elsif (defined *$self->{InputEvent}) { my $got = 1 ; while (length $$out < $size) { last if ($got = *$self->{InputEvent}->($$out, $get_size)) <= 0; } if (length $$out > $size ) { #*$self->{Prime} = substr($$out, $size, length($$out), ''); *$self->{Prime} = substr($$out, $size, length($$out)); substr($$out, $size, length($$out)) = ''; } *$self->{EventEof} = 1 if $got <= 0 ; } else { no warnings 'uninitialized'; my $buf = *$self->{Buffer} ; $$buf = '' unless defined $$buf ; #$$out = '' unless defined $$out ; substr($$out, $offset) = substr($$buf, *$self->{BufferOffset}, $get_size); if (*$self->{ConsumeInput}) { substr($$buf, 0, $get_size) = '' } else { *$self->{BufferOffset} += length($$out) - $offset } } *$self->{InputLengthRemaining} -= length($$out) #- $offset if defined *$self->{InputLength}; $self->saveStatus(length $$out < 0 ? STATUS_ERROR : STATUS_OK) ; return length $$out; } sub pushBack { my $self = shift ; return if ! defined $_[0] || length $_[0] == 0 ; if (defined *$self->{FH} || defined *$self->{InputEvent} ) { *$self->{Prime} = $_[0] . *$self->{Prime} ; *$self->{InputLengthRemaining} += length($_[0]); } else { my $len = length $_[0]; if($len > *$self->{BufferOffset}) { *$self->{Prime} = substr($_[0], 0, $len - *$self->{BufferOffset}) . *$self->{Prime} ; *$self->{InputLengthRemaining} = *$self->{InputLength}; *$self->{BufferOffset} = 0 } else { *$self->{InputLengthRemaining} += length($_[0]); *$self->{BufferOffset} -= length($_[0]) ; } } } sub smartSeek { my $self = shift ; my $offset = shift ; my $truncate = shift; #print "smartSeek to $offset\n"; # TODO -- need to take prime into account if (defined *$self->{FH}) { *$self->{FH}->seek($offset, SEEK_SET) } else { *$self->{BufferOffset} = $offset ; substr(${ *$self->{Buffer} }, *$self->{BufferOffset}) = '' if $truncate; return 1; } } sub smartWrite { my $self = shift ; my $out_data = shift ; if (defined *$self->{FH}) { # flush needed for 5.8.0 defined *$self->{FH}->write($out_data, length $out_data) && defined *$self->{FH}->flush() ; } else { my $buf = *$self->{Buffer} ; substr($$buf, *$self->{BufferOffset}, length $out_data) = $out_data ; *$self->{BufferOffset} += length($out_data) ; return 1; } } sub smartReadExact { return $_[0]->smartRead($_[1], $_[2]) == $_[2]; } sub smartEof { my ($self) = $_[0]; local $.; return 0 if length *$self->{Prime} || *$self->{PushMode}; if (defined *$self->{FH}) { # Could use # # *$self->{FH}->eof() # # here, but this can cause trouble if # the filehandle is itself a tied handle, but it uses sysread. # Then we get into mixing buffered & non-buffered IO, which will cause trouble my $info = $self->getErrInfo(); my $buffer = ''; my $status = $self->smartRead(\$buffer, 1); $self->pushBack($buffer) if length $buffer; $self->setErrInfo($info); return $status == 0 ; } elsif (defined *$self->{InputEvent}) { *$self->{EventEof} } else { *$self->{BufferOffset} >= length(${ *$self->{Buffer} }) } } sub clearError { my $self = shift ; *$self->{ErrorNo} = 0 ; ${ *$self->{Error} } = '' ; } sub getErrInfo { my $self = shift ; return [ *$self->{ErrorNo}, ${ *$self->{Error} } ] ; } sub setErrInfo { my $self = shift ; my $ref = shift; *$self->{ErrorNo} = $ref->[0] ; ${ *$self->{Error} } = $ref->[1] ; } sub saveStatus { my $self = shift ; my $errno = shift() + 0 ; #return $errno unless $errno || ! defined *$self->{ErrorNo}; #return $errno unless $errno ; *$self->{ErrorNo} = $errno; ${ *$self->{Error} } = '' ; return *$self->{ErrorNo} ; } sub saveErrorString { my $self = shift ; my $retval = shift ; #return $retval if ${ *$self->{Error} }; ${ *$self->{Error} } = shift ; *$self->{ErrorNo} = shift() + 0 if @_ ; #warn "saveErrorString: " . ${ *$self->{Error} } . " " . *$self->{Error} . "\n" ; return $retval; } sub croakError { my $self = shift ; $self->saveErrorString(0, $_[0]); croak $_[0]; } sub closeError { my $self = shift ; my $retval = shift ; my $errno = *$self->{ErrorNo}; my $error = ${ *$self->{Error} }; $self->close(); *$self->{ErrorNo} = $errno ; ${ *$self->{Error} } = $error ; return $retval; } sub error { my $self = shift ; return ${ *$self->{Error} } ; } sub errorNo { my $self = shift ; return *$self->{ErrorNo}; } sub HeaderError { my ($self) = shift; return $self->saveErrorString(undef, "Header Error: $_[0]", STATUS_ERROR); } sub TrailerError { my ($self) = shift; return $self->saveErrorString(G_ERR, "Trailer Error: $_[0]", STATUS_ERROR); } sub TruncatedHeader { my ($self) = shift; return $self->HeaderError("Truncated in $_[0] Section"); } sub TruncatedTrailer { my ($self) = shift; return $self->TrailerError("Truncated in $_[0] Section"); } sub postCheckParams { return 1; } sub checkParams { my $self = shift ; my $class = shift ; my $got = shift || IO::Compress::Base::Parameters::new(); my $Valid = { 'BlockSize' => [1, 1, Parse_unsigned, 16 * 1024], 'AutoClose' => [1, 1, Parse_boolean, 0], 'Strict' => [1, 1, Parse_boolean, 0], 'Append' => [1, 1, Parse_boolean, 0], 'Prime' => [1, 1, Parse_any, undef], 'MultiStream' => [1, 1, Parse_boolean, 0], 'Transparent' => [1, 1, Parse_any, 1], 'Scan' => [1, 1, Parse_boolean, 0], 'InputLength' => [1, 1, Parse_unsigned, undef], 'BinModeOut' => [1, 1, Parse_boolean, 0], #'Encode' => [1, 1, Parse_any, undef], #'ConsumeInput' => [1, 1, Parse_boolean, 0], $self->getExtraParams(), #'Todo - Revert to ordinary file on end Z_STREAM_END'=> 0, # ContinueAfterEof } ; $Valid->{TrailingData} = [1, 1, Parse_writable_scalar, undef] if *$self->{OneShot} ; $got->parse($Valid, @_ ) or $self->croakError("${class}: $got->{Error}") ; $self->postCheckParams($got) or $self->croakError("${class}: " . $self->error()) ; return $got; } sub _create { my $obj = shift; my $got = shift; my $append_mode = shift ; my $class = ref $obj; $obj->croakError("$class: Missing Input parameter") if ! @_ && ! $got ; my $inValue = shift ; *$obj->{OneShot} = 0 ; if (! $got) { $got = $obj->checkParams($class, undef, @_) or return undef ; } my $inType = whatIsInput($inValue, 1); $obj->ckInputParam($class, $inValue, 1) or return undef ; *$obj->{InNew} = 1; $obj->ckParams($got) or $obj->croakError("${class}: " . *$obj->{Error}); if ($inType eq 'buffer' || $inType eq 'code') { *$obj->{Buffer} = $inValue ; *$obj->{InputEvent} = $inValue if $inType eq 'code' ; } else { if ($inType eq 'handle') { *$obj->{FH} = $inValue ; *$obj->{Handle} = 1 ; # Need to rewind for Scan *$obj->{FH}->seek(0, SEEK_SET) if $got->value('Scan'); } else { no warnings ; my $mode = '<'; $mode = '+<' if $got->value('Scan'); *$obj->{StdIO} = ($inValue eq '-'); *$obj->{FH} = new IO::File "$mode $inValue" or return $obj->saveErrorString(undef, "cannot open file '$inValue': $!", $!) ; } *$obj->{LineNo} = $. = 0; setBinModeInput(*$obj->{FH}) ; my $buff = "" ; *$obj->{Buffer} = \$buff ; } if ($got->parsed('Encode')) { my $want_encoding = $got->value('Encode'); *$obj->{Encoding} = getEncoding($obj, $class, $want_encoding); } *$obj->{InputLength} = $got->parsed('InputLength') ? $got->value('InputLength') : undef ; *$obj->{InputLengthRemaining} = $got->value('InputLength'); *$obj->{BufferOffset} = 0 ; *$obj->{AutoClose} = $got->value('AutoClose'); *$obj->{Strict} = $got->value('Strict'); *$obj->{BlockSize} = $got->value('BlockSize'); *$obj->{Append} = $got->value('Append'); *$obj->{AppendOutput} = $append_mode || $got->value('Append'); *$obj->{ConsumeInput} = $got->value('ConsumeInput'); *$obj->{Transparent} = $got->value('Transparent'); *$obj->{MultiStream} = $got->value('MultiStream'); # TODO - move these two into RawDeflate *$obj->{Scan} = $got->value('Scan'); *$obj->{ParseExtra} = $got->value('ParseExtra') || $got->value('Strict') ; *$obj->{Type} = ''; *$obj->{Prime} = $got->value('Prime') || '' ; *$obj->{Pending} = ''; *$obj->{Plain} = 0; *$obj->{PlainBytesRead} = 0; *$obj->{InflatedBytesRead} = 0; *$obj->{UnCompSize} = new U64; *$obj->{CompSize} = new U64; *$obj->{TotalInflatedBytesRead} = 0; *$obj->{NewStream} = 0 ; *$obj->{EventEof} = 0 ; *$obj->{ClassName} = $class ; *$obj->{Params} = $got ; if (*$obj->{ConsumeInput}) { *$obj->{InNew} = 0; *$obj->{Closed} = 0; return $obj } my $status = $obj->mkUncomp($got); return undef unless defined $status; if ( ! $status) { return undef unless *$obj->{Transparent}; $obj->clearError(); *$obj->{Type} = 'plain'; *$obj->{Plain} = 1; #$status = $obj->mkIdentityUncomp($class, $got); $obj->pushBack(*$obj->{HeaderPending}) ; } push @{ *$obj->{InfoList} }, *$obj->{Info} ; $obj->saveStatus(STATUS_OK) ; *$obj->{InNew} = 0; *$obj->{Closed} = 0; return $obj; } sub ckInputParam { my $self = shift ; my $from = shift ; my $inType = whatIsInput($_[0], $_[1]); $self->croakError("$from: input parameter not a filename, filehandle, array ref or scalar ref") if ! $inType ; # if ($inType eq 'filename' ) # { # return $self->saveErrorString(1, "$from: input filename is undef or null string", STATUS_ERROR) # if ! defined $_[0] || $_[0] eq '' ; # # if ($_[0] ne '-' && ! -e $_[0] ) # { # return $self->saveErrorString(1, # "input file '$_[0]' does not exist", STATUS_ERROR); # } # } return 1; } sub _inf { my $obj = shift ; my $class = (caller)[0] ; my $name = (caller(1))[3] ; $obj->croakError("$name: expected at least 1 parameters\n") unless @_ >= 1 ; my $input = shift ; my $haveOut = @_ ; my $output = shift ; my $x = new IO::Compress::Base::Validator($class, *$obj->{Error}, $name, $input, $output) or return undef ; push @_, $output if $haveOut && $x->{Hash}; *$obj->{OneShot} = 1 ; my $got = $obj->checkParams($name, undef, @_) or return undef ; if ($got->parsed('TrailingData')) { *$obj->{TrailingData} = $got->value('TrailingData'); } *$obj->{MultiStream} = $got->value('MultiStream'); $got->value('MultiStream', 0); $x->{Got} = $got ; # if ($x->{Hash}) # { # while (my($k, $v) = each %$input) # { # $v = \$input->{$k} # unless defined $v ; # # $obj->_singleTarget($x, $k, $v, @_) # or return undef ; # } # # return keys %$input ; # } if ($x->{GlobMap}) { $x->{oneInput} = 1 ; foreach my $pair (@{ $x->{Pairs} }) { my ($from, $to) = @$pair ; $obj->_singleTarget($x, $from, $to, @_) or return undef ; } return scalar @{ $x->{Pairs} } ; } if (! $x->{oneOutput} ) { my $inFile = ($x->{inType} eq 'filenames' || $x->{inType} eq 'filename'); $x->{inType} = $inFile ? 'filename' : 'buffer'; foreach my $in ($x->{oneInput} ? $input : @$input) { my $out ; $x->{oneInput} = 1 ; $obj->_singleTarget($x, $in, $output, @_) or return undef ; } return 1 ; } # finally the 1 to 1 and n to 1 return $obj->_singleTarget($x, $input, $output, @_); croak "should not be here" ; } sub retErr { my $x = shift ; my $string = shift ; ${ $x->{Error} } = $string ; return undef ; } sub _singleTarget { my $self = shift ; my $x = shift ; my $input = shift; my $output = shift; my $buff = ''; $x->{buff} = \$buff ; my $fh ; if ($x->{outType} eq 'filename') { my $mode = '>' ; $mode = '>>' if $x->{Got}->value('Append') ; $x->{fh} = new IO::File "$mode $output" or return retErr($x, "cannot open file '$output': $!") ; binmode $x->{fh} if $x->{Got}->valueOrDefault('BinModeOut'); } elsif ($x->{outType} eq 'handle') { $x->{fh} = $output; binmode $x->{fh} if $x->{Got}->valueOrDefault('BinModeOut'); if ($x->{Got}->value('Append')) { seek($x->{fh}, 0, SEEK_END) or return retErr($x, "Cannot seek to end of output filehandle: $!") ; } } elsif ($x->{outType} eq 'buffer' ) { $$output = '' unless $x->{Got}->value('Append'); $x->{buff} = $output ; } if ($x->{oneInput}) { defined $self->_rd2($x, $input, $output) or return undef; } else { for my $element ( ($x->{inType} eq 'hash') ? keys %$input : @$input) { defined $self->_rd2($x, $element, $output) or return undef ; } } if ( ($x->{outType} eq 'filename' && $output ne '-') || ($x->{outType} eq 'handle' && $x->{Got}->value('AutoClose'))) { $x->{fh}->close() or return retErr($x, $!); delete $x->{fh}; } return 1 ; } sub _rd2 { my $self = shift ; my $x = shift ; my $input = shift; my $output = shift; my $z = createSelfTiedObject($x->{Class}, *$self->{Error}); $z->_create($x->{Got}, 1, $input, @_) or return undef ; my $status ; my $fh = $x->{fh}; while (1) { while (($status = $z->read($x->{buff})) > 0) { if ($fh) { print $fh ${ $x->{buff} } or return $z->saveErrorString(undef, "Error writing to output file: $!", $!); ${ $x->{buff} } = '' ; } } if (! $x->{oneOutput} ) { my $ot = $x->{outType} ; if ($ot eq 'array') { push @$output, $x->{buff} } elsif ($ot eq 'hash') { $output->{$input} = $x->{buff} } my $buff = ''; $x->{buff} = \$buff; } last if $status < 0 || $z->smartEof(); #last if $status < 0 ; last unless *$self->{MultiStream}; $status = $z->nextStream(); last unless $status == 1 ; } return $z->closeError(undef) if $status < 0 ; ${ *$self->{TrailingData} } = $z->trailingData() if defined *$self->{TrailingData} ; $z->close() or return undef ; return 1 ; } sub TIEHANDLE { return $_[0] if ref($_[0]); die "OOPS\n" ; } sub UNTIE { my $self = shift ; } sub getHeaderInfo { my $self = shift ; wantarray ? @{ *$self->{InfoList} } : *$self->{Info}; } sub readBlock { my $self = shift ; my $buff = shift ; my $size = shift ; if (defined *$self->{CompressedInputLength}) { if (*$self->{CompressedInputLengthRemaining} == 0) { delete *$self->{CompressedInputLength}; *$self->{CompressedInputLengthDone} = 1; return STATUS_OK ; } $size = min($size, *$self->{CompressedInputLengthRemaining} ); *$self->{CompressedInputLengthRemaining} -= $size ; } my $status = $self->smartRead($buff, $size) ; return $self->saveErrorString(STATUS_ERROR, "Error Reading Data") if $status < 0 ; if ($status == 0 ) { *$self->{Closed} = 1 ; *$self->{EndStream} = 1 ; return $self->saveErrorString(STATUS_ERROR, "unexpected end of file", STATUS_ERROR); } return STATUS_OK; } sub postBlockChk { return STATUS_OK; } sub _raw_read { # return codes # >0 - ok, number of bytes read # =0 - ok, eof # <0 - not ok my $self = shift ; return G_EOF if *$self->{Closed} ; #return G_EOF if !length *$self->{Pending} && *$self->{EndStream} ; return G_EOF if *$self->{EndStream} ; my $buffer = shift ; my $scan_mode = shift ; if (*$self->{Plain}) { my $tmp_buff ; my $len = $self->smartRead(\$tmp_buff, *$self->{BlockSize}) ; return $self->saveErrorString(G_ERR, "Error reading data: $!", $!) if $len < 0 ; if ($len == 0 ) { *$self->{EndStream} = 1 ; } else { *$self->{PlainBytesRead} += $len ; $$buffer .= $tmp_buff; } return $len ; } if (*$self->{NewStream}) { $self->gotoNextStream() > 0 or return G_ERR; # For the headers that actually uncompressed data, put the # uncompressed data into the output buffer. $$buffer .= *$self->{Pending} ; my $len = length *$self->{Pending} ; *$self->{Pending} = ''; return $len; } my $temp_buf = ''; my $outSize = 0; my $status = $self->readBlock(\$temp_buf, *$self->{BlockSize}, $outSize) ; return G_ERR if $status == STATUS_ERROR ; my $buf_len = 0; if ($status == STATUS_OK) { my $beforeC_len = length $temp_buf; my $before_len = defined $$buffer ? length $$buffer : 0 ; $status = *$self->{Uncomp}->uncompr(\$temp_buf, $buffer, defined *$self->{CompressedInputLengthDone} || $self->smartEof(), $outSize); # Remember the input buffer if it wasn't consumed completely $self->pushBack($temp_buf) if *$self->{Uncomp}{ConsumesInput}; return $self->saveErrorString(G_ERR, *$self->{Uncomp}{Error}, *$self->{Uncomp}{ErrorNo}) if $self->saveStatus($status) == STATUS_ERROR; $self->postBlockChk($buffer, $before_len) == STATUS_OK or return G_ERR; $buf_len = defined $$buffer ? length($$buffer) - $before_len : 0; *$self->{CompSize}->add($beforeC_len - length $temp_buf) ; *$self->{InflatedBytesRead} += $buf_len ; *$self->{TotalInflatedBytesRead} += $buf_len ; *$self->{UnCompSize}->add($buf_len) ; $self->filterUncompressed($buffer); if (*$self->{Encoding}) { $$buffer = *$self->{Encoding}->decode($$buffer); } } if ($status == STATUS_ENDSTREAM) { *$self->{EndStream} = 1 ; #$self->pushBack($temp_buf) ; #$temp_buf = ''; my $trailer; my $trailer_size = *$self->{Info}{TrailerLength} ; my $got = 0; if (*$self->{Info}{TrailerLength}) { $got = $self->smartRead(\$trailer, $trailer_size) ; } if ($got == $trailer_size) { $self->chkTrailer($trailer) == STATUS_OK or return G_ERR; } else { return $self->TrailerError("trailer truncated. Expected " . "$trailer_size bytes, got $got") if *$self->{Strict}; $self->pushBack($trailer) ; } # TODO - if want to file file pointer, do it here if (! $self->smartEof()) { *$self->{NewStream} = 1 ; if (*$self->{MultiStream}) { *$self->{EndStream} = 0 ; return $buf_len ; } } } # return the number of uncompressed bytes read return $buf_len ; } sub reset { my $self = shift ; return *$self->{Uncomp}->reset(); } sub filterUncompressed { } #sub isEndStream #{ # my $self = shift ; # return *$self->{NewStream} || # *$self->{EndStream} ; #} sub nextStream { my $self = shift ; my $status = $self->gotoNextStream(); $status == 1 or return $status ; *$self->{TotalInflatedBytesRead} = 0 ; *$self->{LineNo} = $. = 0; return 1; } sub gotoNextStream { my $self = shift ; if (! *$self->{NewStream}) { my $status = 1; my $buffer ; # TODO - make this more efficient if know the offset for the end of # the stream and seekable $status = $self->read($buffer) while $status > 0 ; return $status if $status < 0; } *$self->{NewStream} = 0 ; *$self->{EndStream} = 0 ; $self->reset(); *$self->{UnCompSize}->reset(); *$self->{CompSize}->reset(); my $magic = $self->ckMagic(); #*$self->{EndStream} = 0 ; if ( ! defined $magic) { if (! *$self->{Transparent} ) { *$self->{EndStream} = 1 ; return 0; } $self->clearError(); *$self->{Type} = 'plain'; *$self->{Plain} = 1; $self->pushBack(*$self->{HeaderPending}) ; } else { *$self->{Info} = $self->readHeader($magic); if ( ! defined *$self->{Info} ) { *$self->{EndStream} = 1 ; return -1; } } push @{ *$self->{InfoList} }, *$self->{Info} ; return 1; } sub streamCount { my $self = shift ; return 1 if ! defined *$self->{InfoList}; return scalar @{ *$self->{InfoList} } ; } sub read { # return codes # >0 - ok, number of bytes read # =0 - ok, eof # <0 - not ok my $self = shift ; return G_EOF if *$self->{Closed} ; my $buffer ; if (ref $_[0] ) { $self->croakError(*$self->{ClassName} . "::read: buffer parameter is read-only") if readonly(${ $_[0] }); $self->croakError(*$self->{ClassName} . "::read: not a scalar reference $_[0]" ) unless ref $_[0] eq 'SCALAR' ; $buffer = $_[0] ; } else { $self->croakError(*$self->{ClassName} . "::read: buffer parameter is read-only") if readonly($_[0]); $buffer = \$_[0] ; } my $length = $_[1] ; my $offset = $_[2] || 0; if (! *$self->{AppendOutput}) { if (! $offset) { $$buffer = '' ; } else { if ($offset > length($$buffer)) { $$buffer .= "\x00" x ($offset - length($$buffer)); } else { substr($$buffer, $offset) = ''; } } } return G_EOF if !length *$self->{Pending} && *$self->{EndStream} ; # the core read will return 0 if asked for 0 bytes return 0 if defined $length && $length == 0 ; $length = $length || 0; $self->croakError(*$self->{ClassName} . "::read: length parameter is negative") if $length < 0 ; # Short-circuit if this is a simple read, with no length # or offset specified. unless ( $length || $offset) { if (length *$self->{Pending}) { $$buffer .= *$self->{Pending} ; my $len = length *$self->{Pending}; *$self->{Pending} = '' ; return $len ; } else { my $len = 0; $len = $self->_raw_read($buffer) while ! *$self->{EndStream} && $len == 0 ; return $len ; } } # Need to jump through more hoops - either length or offset # or both are specified. my $out_buffer = *$self->{Pending} ; *$self->{Pending} = ''; while (! *$self->{EndStream} && length($out_buffer) < $length) { my $buf_len = $self->_raw_read(\$out_buffer); return $buf_len if $buf_len < 0 ; } $length = length $out_buffer if length($out_buffer) < $length ; return 0 if $length == 0 ; $$buffer = '' if ! defined $$buffer; $offset = length $$buffer if *$self->{AppendOutput} ; *$self->{Pending} = $out_buffer; $out_buffer = \*$self->{Pending} ; #substr($$buffer, $offset) = substr($$out_buffer, 0, $length, '') ; substr($$buffer, $offset) = substr($$out_buffer, 0, $length) ; substr($$out_buffer, 0, $length) = '' ; return $length ; } sub _getline { my $self = shift ; # Slurp Mode if ( ! defined $/ ) { my $data ; 1 while $self->read($data) > 0 ; return \$data ; } # Record Mode if ( ref $/ eq 'SCALAR' && ${$/} =~ /^\d+$/ && ${$/} > 0) { my $reclen = ${$/} ; my $data ; $self->read($data, $reclen) ; return \$data ; } # Paragraph Mode if ( ! length $/ ) { my $paragraph ; while ($self->read($paragraph) > 0 ) { if ($paragraph =~ s/^(.*?\n\n+)//s) { *$self->{Pending} = $paragraph ; my $par = $1 ; return \$par ; } } return \$paragraph; } # $/ isn't empty, or a reference, so it's Line Mode. { my $line ; my $offset; my $p = \*$self->{Pending} ; if (length(*$self->{Pending}) && ($offset = index(*$self->{Pending}, $/)) >=0) { my $l = substr(*$self->{Pending}, 0, $offset + length $/ ); substr(*$self->{Pending}, 0, $offset + length $/) = ''; return \$l; } while ($self->read($line) > 0 ) { my $offset = index($line, $/); if ($offset >= 0) { my $l = substr($line, 0, $offset + length $/ ); substr($line, 0, $offset + length $/) = ''; $$p = $line; return \$l; } } return \$line; } } sub getline { my $self = shift; my $current_append = *$self->{AppendOutput} ; *$self->{AppendOutput} = 1; my $lineref = $self->_getline(); $. = ++ *$self->{LineNo} if defined $$lineref ; *$self->{AppendOutput} = $current_append; return $$lineref ; } sub getlines { my $self = shift; $self->croakError(*$self->{ClassName} . "::getlines: called in scalar context\n") unless wantarray; my($line, @lines); push(@lines, $line) while defined($line = $self->getline); return @lines; } sub READLINE { goto &getlines if wantarray; goto &getline; } sub getc { my $self = shift; my $buf; return $buf if $self->read($buf, 1); return undef; } sub ungetc { my $self = shift; *$self->{Pending} = "" unless defined *$self->{Pending} ; *$self->{Pending} = $_[0] . *$self->{Pending} ; } sub trailingData { my $self = shift ; if (defined *$self->{FH} || defined *$self->{InputEvent} ) { return *$self->{Prime} ; } else { my $buf = *$self->{Buffer} ; my $offset = *$self->{BufferOffset} ; return substr($$buf, $offset) ; } } sub eof { my $self = shift ; return (*$self->{Closed} || (!length *$self->{Pending} && ( $self->smartEof() || *$self->{EndStream}))) ; } sub tell { my $self = shift ; my $in ; if (*$self->{Plain}) { $in = *$self->{PlainBytesRead} ; } else { $in = *$self->{TotalInflatedBytesRead} ; } my $pending = length *$self->{Pending} ; return 0 if $pending > $in ; return $in - $pending ; } sub close { # todo - what to do if close is called before the end of the gzip file # do we remember any trailing data? my $self = shift ; return 1 if *$self->{Closed} ; untie *$self if $] >= 5.008 ; my $status = 1 ; if (defined *$self->{FH}) { if ((! *$self->{Handle} || *$self->{AutoClose}) && ! *$self->{StdIO}) { #if ( *$self->{AutoClose}) { local $.; $! = 0 ; $status = *$self->{FH}->close(); return $self->saveErrorString(0, $!, $!) if !*$self->{InNew} && $self->saveStatus($!) != 0 ; } delete *$self->{FH} ; $! = 0 ; } *$self->{Closed} = 1 ; return 1; } sub DESTROY { my $self = shift ; local ($., $@, $!, $^E, $?); $self->close() ; } sub seek { my $self = shift ; my $position = shift; my $whence = shift ; my $here = $self->tell() ; my $target = 0 ; if ($whence == SEEK_SET) { $target = $position ; } elsif ($whence == SEEK_CUR) { $target = $here + $position ; } elsif ($whence == SEEK_END) { $target = $position ; $self->croakError(*$self->{ClassName} . "::seek: SEEK_END not allowed") ; } else { $self->croakError(*$self->{ClassName} ."::seek: unknown value, $whence, for whence parameter"); } # short circuit if seeking to current offset if ($target == $here) { # On ordinary filehandles, seeking to the current # position also clears the EOF condition, so we # emulate this behavior locally while simultaneously # cascading it to the underlying filehandle if (*$self->{Plain}) { *$self->{EndStream} = 0; seek(*$self->{FH},0,1) if *$self->{FH}; } return 1; } # Outlaw any attempt to seek backwards $self->croakError( *$self->{ClassName} ."::seek: cannot seek backwards") if $target < $here ; # Walk the file to the new offset my $offset = $target - $here ; my $got; while (($got = $self->read(my $buffer, min($offset, *$self->{BlockSize})) ) > 0) { $offset -= $got; last if $offset == 0 ; } $here = $self->tell() ; return $offset == 0 ? 1 : 0 ; } sub fileno { my $self = shift ; return defined *$self->{FH} ? fileno *$self->{FH} : undef ; } sub binmode { 1; # my $self = shift ; # return defined *$self->{FH} # ? binmode *$self->{FH} # : 1 ; } sub opened { my $self = shift ; return ! *$self->{Closed} ; } sub autoflush { my $self = shift ; return defined *$self->{FH} ? *$self->{FH}->autoflush(@_) : undef ; } sub input_line_number { my $self = shift ; my $last = *$self->{LineNo}; $. = *$self->{LineNo} = $_[1] if @_ ; return $last; } *BINMODE = \&binmode; *SEEK = \&seek; *READ = \&read; *sysread = \&read; *TELL = \&tell; *EOF = \&eof; *FILENO = \&fileno; *CLOSE = \&close; sub _notAvailable { my $name = shift ; #return sub { croak "$name Not Available" ; } ; return sub { croak "$name Not Available: File opened only for intput" ; } ; } *print = _notAvailable('print'); *PRINT = _notAvailable('print'); *printf = _notAvailable('printf'); *PRINTF = _notAvailable('printf'); *write = _notAvailable('write'); *WRITE = _notAvailable('write'); #*sysread = \&read; #*syswrite = \&_notAvailable; package IO::Uncompress::Base ; 1 ; __END__ #line 1475 FILE fe186dbb/IO/Uncompress/Gunzip.pm$#line 1 "/usr/lib/perl5/5.12.2/IO/Uncompress/Gunzip.pm" package IO::Uncompress::Gunzip ; require 5.004 ; # for RFC1952 use strict ; use warnings; use bytes; use IO::Uncompress::RawInflate 2.024 ; use Compress::Raw::Zlib 2.024 qw( crc32 ) ; use IO::Compress::Base::Common 2.024 qw(:Status createSelfTiedObject); use IO::Compress::Gzip::Constants 2.024 ; use IO::Compress::Zlib::Extra 2.024 ; require Exporter ; our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS, $GunzipError); @ISA = qw( Exporter IO::Uncompress::RawInflate ); @EXPORT_OK = qw( $GunzipError gunzip ); %EXPORT_TAGS = %IO::Uncompress::RawInflate::DEFLATE_CONSTANTS ; push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; Exporter::export_ok_tags('all'); $GunzipError = ''; $VERSION = '2.024'; sub new { my $class = shift ; $GunzipError = ''; my $obj = createSelfTiedObject($class, \$GunzipError); $obj->_create(undef, 0, @_); } sub gunzip { my $obj = createSelfTiedObject(undef, \$GunzipError); return $obj->_inf(@_) ; } sub getExtraParams { use IO::Compress::Base::Common 2.024 qw(:Parse); return ( 'ParseExtra' => [1, 1, Parse_boolean, 0] ) ; } sub ckParams { my $self = shift ; my $got = shift ; # gunzip always needs crc32 $got->value('CRC32' => 1); return 1; } sub ckMagic { my $self = shift; my $magic ; $self->smartReadExact(\$magic, GZIP_ID_SIZE); *$self->{HeaderPending} = $magic ; return $self->HeaderError("Minimum header size is " . GZIP_MIN_HEADER_SIZE . " bytes") if length $magic != GZIP_ID_SIZE ; return $self->HeaderError("Bad Magic") if ! isGzipMagic($magic) ; *$self->{Type} = 'rfc1952'; return $magic ; } sub readHeader { my $self = shift; my $magic = shift; return $self->_readGzipHeader($magic); } sub chkTrailer { my $self = shift; my $trailer = shift; # Check CRC & ISIZE my ($CRC32, $ISIZE) = unpack("V V", $trailer) ; *$self->{Info}{CRC32} = $CRC32; *$self->{Info}{ISIZE} = $ISIZE; if (*$self->{Strict}) { return $self->TrailerError("CRC mismatch") if $CRC32 != *$self->{Uncomp}->crc32() ; my $exp_isize = *$self->{UnCompSize}->get32bit(); return $self->TrailerError("ISIZE mismatch. Got $ISIZE" . ", expected $exp_isize") if $ISIZE != $exp_isize ; } return STATUS_OK; } sub isGzipMagic { my $buffer = shift ; return 0 if length $buffer < GZIP_ID_SIZE ; my ($id1, $id2) = unpack("C C", $buffer) ; return $id1 == GZIP_ID1 && $id2 == GZIP_ID2 ; } sub _readFullGzipHeader($) { my ($self) = @_ ; my $magic = '' ; $self->smartReadExact(\$magic, GZIP_ID_SIZE); *$self->{HeaderPending} = $magic ; return $self->HeaderError("Minimum header size is " . GZIP_MIN_HEADER_SIZE . " bytes") if length $magic != GZIP_ID_SIZE ; return $self->HeaderError("Bad Magic") if ! isGzipMagic($magic) ; my $status = $self->_readGzipHeader($magic); delete *$self->{Transparent} if ! defined $status ; return $status ; } sub _readGzipHeader($) { my ($self, $magic) = @_ ; my ($HeaderCRC) ; my ($buffer) = '' ; $self->smartReadExact(\$buffer, GZIP_MIN_HEADER_SIZE - GZIP_ID_SIZE) or return $self->HeaderError("Minimum header size is " . GZIP_MIN_HEADER_SIZE . " bytes") ; my $keep = $magic . $buffer ; *$self->{HeaderPending} = $keep ; # now split out the various parts my ($cm, $flag, $mtime, $xfl, $os) = unpack("C C V C C", $buffer) ; $cm == GZIP_CM_DEFLATED or return $self->HeaderError("Not Deflate (CM is $cm)") ; # check for use of reserved bits return $self->HeaderError("Use of Reserved Bits in FLG field.") if $flag & GZIP_FLG_RESERVED ; my $EXTRA ; my @EXTRA = () ; if ($flag & GZIP_FLG_FEXTRA) { $EXTRA = "" ; $self->smartReadExact(\$buffer, GZIP_FEXTRA_HEADER_SIZE) or return $self->TruncatedHeader("FEXTRA Length") ; my ($XLEN) = unpack("v", $buffer) ; $self->smartReadExact(\$EXTRA, $XLEN) or return $self->TruncatedHeader("FEXTRA Body"); $keep .= $buffer . $EXTRA ; if ($XLEN && *$self->{'ParseExtra'}) { my $bad = IO::Compress::Zlib::Extra::parseRawExtra($EXTRA, \@EXTRA, 1, 1); return $self->HeaderError($bad) if defined $bad; } } my $origname ; if ($flag & GZIP_FLG_FNAME) { $origname = "" ; while (1) { $self->smartReadExact(\$buffer, 1) or return $self->TruncatedHeader("FNAME"); last if $buffer eq GZIP_NULL_BYTE ; $origname .= $buffer } $keep .= $origname . GZIP_NULL_BYTE ; return $self->HeaderError("Non ISO 8859-1 Character found in Name") if *$self->{Strict} && $origname =~ /$GZIP_FNAME_INVALID_CHAR_RE/o ; } my $comment ; if ($flag & GZIP_FLG_FCOMMENT) { $comment = ""; while (1) { $self->smartReadExact(\$buffer, 1) or return $self->TruncatedHeader("FCOMMENT"); last if $buffer eq GZIP_NULL_BYTE ; $comment .= $buffer } $keep .= $comment . GZIP_NULL_BYTE ; return $self->HeaderError("Non ISO 8859-1 Character found in Comment") if *$self->{Strict} && $comment =~ /$GZIP_FCOMMENT_INVALID_CHAR_RE/o ; } if ($flag & GZIP_FLG_FHCRC) { $self->smartReadExact(\$buffer, GZIP_FHCRC_SIZE) or return $self->TruncatedHeader("FHCRC"); $HeaderCRC = unpack("v", $buffer) ; my $crc16 = crc32($keep) & 0xFF ; return $self->HeaderError("CRC16 mismatch.") if *$self->{Strict} && $crc16 != $HeaderCRC; $keep .= $buffer ; } # Assume compression method is deflated for xfl tests #if ($xfl) { #} *$self->{Type} = 'rfc1952'; return { 'Type' => 'rfc1952', 'FingerprintLength' => 2, 'HeaderLength' => length $keep, 'TrailerLength' => GZIP_TRAILER_SIZE, 'Header' => $keep, 'isMinimalHeader' => $keep eq GZIP_MINIMUM_HEADER ? 1 : 0, 'MethodID' => $cm, 'MethodName' => $cm == GZIP_CM_DEFLATED ? "Deflated" : "Unknown" , 'TextFlag' => $flag & GZIP_FLG_FTEXT ? 1 : 0, 'HeaderCRCFlag' => $flag & GZIP_FLG_FHCRC ? 1 : 0, 'NameFlag' => $flag & GZIP_FLG_FNAME ? 1 : 0, 'CommentFlag' => $flag & GZIP_FLG_FCOMMENT ? 1 : 0, 'ExtraFlag' => $flag & GZIP_FLG_FEXTRA ? 1 : 0, 'Name' => $origname, 'Comment' => $comment, 'Time' => $mtime, 'OsID' => $os, 'OsName' => defined $GZIP_OS_Names{$os} ? $GZIP_OS_Names{$os} : "Unknown", 'HeaderCRC' => $HeaderCRC, 'Flags' => $flag, 'ExtraFlags' => $xfl, 'ExtraFieldRaw' => $EXTRA, 'ExtraField' => [ @EXTRA ], #'CompSize'=> $compsize, #'CRC32'=> $CRC32, #'OrigSize'=> $ISIZE, } } 1; __END__ #line 1112 FILE$2aa9d7a1/IO/Uncompress/RawInflate.pm"#line 1 "/usr/lib/perl5/5.12.2/IO/Uncompress/RawInflate.pm" package IO::Uncompress::RawInflate ; # for RFC1951 use strict ; use warnings; use bytes; use Compress::Raw::Zlib 2.024 ; use IO::Compress::Base::Common 2.024 qw(:Status createSelfTiedObject); use IO::Uncompress::Base 2.024 ; use IO::Uncompress::Adapter::Inflate 2.024 ; require Exporter ; our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS, %DEFLATE_CONSTANTS, $RawInflateError); $VERSION = '2.024'; $RawInflateError = ''; @ISA = qw( Exporter IO::Uncompress::Base ); @EXPORT_OK = qw( $RawInflateError rawinflate ) ; %DEFLATE_CONSTANTS = (); %EXPORT_TAGS = %IO::Uncompress::Base::EXPORT_TAGS ; push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; Exporter::export_ok_tags('all'); #{ # # Execute at runtime # my %bad; # for my $module (qw(Compress::Raw::Zlib IO::Compress::Base::Common IO::Uncompress::Base IO::Uncompress::Adapter::Inflate)) # { # my $ver = ${ $module . "::VERSION"} ; # # $bad{$module} = $ver # if $ver ne $VERSION; # } # # if (keys %bad) # { # my $string = join "\n", map { "$_ $bad{$_}" } keys %bad; # die caller(0)[0] . "needs version $VERSION mismatch\n$string\n"; # } #} sub new { my $class = shift ; my $obj = createSelfTiedObject($class, \$RawInflateError); $obj->_create(undef, 0, @_); } sub rawinflate { my $obj = createSelfTiedObject(undef, \$RawInflateError); return $obj->_inf(@_); } sub getExtraParams { return (); } sub ckParams { my $self = shift ; my $got = shift ; return 1; } sub mkUncomp { my $self = shift ; my $got = shift ; my ($obj, $errstr, $errno) = IO::Uncompress::Adapter::Inflate::mkUncompObject( $got->value('CRC32'), $got->value('ADLER32'), $got->value('Scan'), ); return $self->saveErrorString(undef, $errstr, $errno) if ! defined $obj; *$self->{Uncomp} = $obj; my $magic = $self->ckMagic() or return 0; *$self->{Info} = $self->readHeader($magic) or return undef ; return 1; } sub ckMagic { my $self = shift; return $self->_isRaw() ; } sub readHeader { my $self = shift; my $magic = shift ; return { 'Type' => 'rfc1951', 'FingerprintLength' => 0, 'HeaderLength' => 0, 'TrailerLength' => 0, 'Header' => '' }; } sub chkTrailer { return STATUS_OK ; } sub _isRaw { my $self = shift ; my $got = $self->_isRawx(@_); if ($got) { *$self->{Pending} = *$self->{HeaderPending} ; } else { $self->pushBack(*$self->{HeaderPending}); *$self->{Uncomp}->reset(); } *$self->{HeaderPending} = ''; return $got ; } sub _isRawx { my $self = shift ; my $magic = shift ; $magic = '' unless defined $magic ; my $buffer = ''; $self->smartRead(\$buffer, *$self->{BlockSize}) >= 0 or return $self->saveErrorString(undef, "No data to read"); my $temp_buf = $magic . $buffer ; *$self->{HeaderPending} = $temp_buf ; $buffer = ''; my $status = *$self->{Uncomp}->uncompr(\$temp_buf, \$buffer, $self->smartEof()) ; return $self->saveErrorString(undef, *$self->{Uncomp}{Error}, STATUS_ERROR) if $status == STATUS_ERROR; $self->pushBack($temp_buf) ; return $self->saveErrorString(undef, "unexpected end of file", STATUS_ERROR) if $self->smartEof() && $status != STATUS_ENDSTREAM; #my $buf_len = *$self->{Uncomp}->uncompressedBytes(); my $buf_len = length $buffer; if ($status == STATUS_ENDSTREAM) { if (*$self->{MultiStream} && (length $temp_buf || ! $self->smartEof())){ *$self->{NewStream} = 1 ; *$self->{EndStream} = 0 ; } else { *$self->{EndStream} = 1 ; } } *$self->{HeaderPending} = $buffer ; *$self->{InflatedBytesRead} = $buf_len ; *$self->{TotalInflatedBytesRead} += $buf_len ; *$self->{Type} = 'rfc1951'; $self->saveStatus(STATUS_OK); return { 'Type' => 'rfc1951', 'HeaderLength' => 0, 'TrailerLength' => 0, 'Header' => '' }; } sub inflateSync { my $self = shift ; # inflateSync is a no-op in Plain mode return 1 if *$self->{Plain} ; return 0 if *$self->{Closed} ; #return G_EOF if !length *$self->{Pending} && *$self->{EndStream} ; return 0 if ! length *$self->{Pending} && *$self->{EndStream} ; # Disable CRC check *$self->{Strict} = 0 ; my $status ; while (1) { my $temp_buf ; if (length *$self->{Pending} ) { $temp_buf = *$self->{Pending} ; *$self->{Pending} = ''; } else { $status = $self->smartRead(\$temp_buf, *$self->{BlockSize}) ; return $self->saveErrorString(0, "Error Reading Data") if $status < 0 ; if ($status == 0 ) { *$self->{EndStream} = 1 ; return $self->saveErrorString(0, "unexpected end of file", STATUS_ERROR); } } $status = *$self->{Uncomp}->sync($temp_buf) ; if ($status == STATUS_OK) { *$self->{Pending} .= $temp_buf ; return 1 ; } last unless $status == STATUS_ERROR ; } return 0; } #sub performScan #{ # my $self = shift ; # # my $status ; # my $end_offset = 0; # # $status = $self->scan() # #or return $self->saveErrorString(undef, "Error Scanning: $$error_ref", $self->errorNo) ; # or return $self->saveErrorString(G_ERR, "Error Scanning: $status") # # $status = $self->zap($end_offset) # or return $self->saveErrorString(G_ERR, "Error Zapping: $status"); # #or return $self->saveErrorString(undef, "Error Zapping: $$error_ref", $self->errorNo) ; # # #(*$obj->{Deflate}, $status) = $inf->createDeflate(); # ## *$obj->{Header} = *$inf->{Info}{Header}; ## *$obj->{UnCompSize_32bit} = ## *$obj->{BytesWritten} = *$inf->{UnCompSize_32bit} ; ## *$obj->{CompSize_32bit} = *$inf->{CompSize_32bit} ; # # ## if ( $outType eq 'buffer') ## { substr( ${ *$self->{Buffer} }, $end_offset) = '' } ## elsif ($outType eq 'handle' || $outType eq 'filename') { ## *$self->{FH} = *$inf->{FH} ; ## delete *$inf->{FH}; ## *$obj->{FH}->flush() ; ## *$obj->{Handle} = 1 if $outType eq 'handle'; ## ## #seek(*$obj->{FH}, $end_offset, SEEK_SET) ## *$obj->{FH}->seek($end_offset, SEEK_SET) ## or return $obj->saveErrorString(undef, $!, $!) ; ## } # #} sub scan { my $self = shift ; return 1 if *$self->{Closed} ; return 1 if !length *$self->{Pending} && *$self->{EndStream} ; my $buffer = '' ; my $len = 0; $len = $self->_raw_read(\$buffer, 1) while ! *$self->{EndStream} && $len >= 0 ; #return $len if $len < 0 ? $len : 0 ; return $len < 0 ? 0 : 1 ; } sub zap { my $self = shift ; my $headerLength = *$self->{Info}{HeaderLength}; my $block_offset = $headerLength + *$self->{Uncomp}->getLastBlockOffset(); $_[0] = $headerLength + *$self->{Uncomp}->getEndOffset(); #printf "# End $_[0], headerlen $headerLength \n";; #printf "# block_offset $block_offset %x\n", $block_offset; my $byte ; ( $self->smartSeek($block_offset) && $self->smartRead(\$byte, 1) ) or return $self->saveErrorString(0, $!, $!); #printf "#byte is %x\n", unpack('C*',$byte); *$self->{Uncomp}->resetLastBlockByte($byte); #printf "#to byte is %x\n", unpack('C*',$byte); ( $self->smartSeek($block_offset) && $self->smartWrite($byte) ) or return $self->saveErrorString(0, $!, $!); #$self->smartSeek($end_offset, 1); return 1 ; } sub createDeflate { my $self = shift ; my ($def, $status) = *$self->{Uncomp}->createDeflateStream( -AppendOutput => 1, -WindowBits => - MAX_WBITS, -CRC32 => *$self->{Params}->value('CRC32'), -ADLER32 => *$self->{Params}->value('ADLER32'), ); return wantarray ? ($status, $def) : $def ; } 1; __END__ #line 1111 FILE99fae642/PerlIO.pm#line 1 "/usr/lib/perl5/5.12.2/PerlIO.pm" package PerlIO; our $VERSION = '1.06'; # Map layer name to package that defines it our %alias; sub import { my $class = shift; while (@_) { my $layer = shift; if (exists $alias{$layer}) { $layer = $alias{$layer} } else { $layer = "${class}::$layer"; } eval "require $layer"; warn $@ if $@; } } sub F_UTF8 () { 0x8000 } 1; __END__ #line 345 FILEfbaff572/SelectSaver.pm#line 1 "/usr/lib/perl5/5.12.2/SelectSaver.pm" package SelectSaver; our $VERSION = '1.02'; #line 36 require 5.000; use Carp; use Symbol; sub new { @_ >= 1 && @_ <= 2 or croak 'usage: SelectSaver->new( [FILEHANDLE] )'; my $fh = select; my $self = bless \$fh, $_[0]; select qualify($_[1], caller) if @_ > 1; $self; } sub DESTROY { my $self = $_[0]; select $$self; } 1; FILE28ea574b/Symbol.pmh#line 1 "/usr/lib/perl5/5.12.2/Symbol.pm" package Symbol; #line 80 BEGIN { require 5.005; } require Exporter; @ISA = qw(Exporter); @EXPORT = qw(gensym ungensym qualify qualify_to_ref); @EXPORT_OK = qw(delete_package geniosym); $VERSION = '1.07'; my $genpkg = "Symbol::"; my $genseq = 0; my %global = map {$_ => 1} qw(ARGV ARGVOUT ENV INC SIG STDERR STDIN STDOUT); # # Note that we never _copy_ the glob; we just make a ref to it. # If we did copy it, then SVf_FAKE would be set on the copy, and # glob-specific behaviors (e.g. C<*$ref = \&func>) wouldn't work. # sub gensym () { my $name = "GEN" . $genseq++; my $ref = \*{$genpkg . $name}; delete $$genpkg{$name}; $ref; } sub geniosym () { my $sym = gensym(); # force the IO slot to be filled select(select $sym); *$sym{IO}; } sub ungensym ($) {} sub qualify ($;$) { my ($name) = @_; if (!ref($name) && index($name, '::') == -1 && index($name, "'") == -1) { my $pkg; # Global names: special character, "^xyz", or other. if ($name =~ /^(([^a-z])|(\^[a-z_]+))\z/i || $global{$name}) { # RGS 2001-11-05 : translate leading ^X to control-char $name =~ s/^\^([a-z_])/'qq(\c'.$1.')'/eei; $pkg = "main"; } else { $pkg = (@_ > 1) ? $_[1] : caller; } $name = $pkg . "::" . $name; } $name; } sub qualify_to_ref ($;$) { return \*{ qualify $_[0], @_ > 1 ? $_[1] : caller }; } # # of Safe.pm lineage # sub delete_package ($) { my $pkg = shift; # expand to full symbol table name if needed unless ($pkg =~ /^main::.*::$/) { $pkg = "main$pkg" if $pkg =~ /^::/; $pkg = "main::$pkg" unless $pkg =~ /^main::/; $pkg .= '::' unless $pkg =~ /::$/; } my($stem, $leaf) = $pkg =~ m/(.*::)(\w+::)$/; my $stem_symtab = *{$stem}{HASH}; return unless defined $stem_symtab and exists $stem_symtab->{$leaf}; # free all the symbols in the package my $leaf_symtab = *{$stem_symtab->{$leaf}}{HASH}; foreach my $name (keys %$leaf_symtab) { undef *{$pkg . $name}; } # delete the symbol table %$leaf_symtab = (); delete $stem_symtab->{$leaf}; } 1; FILE!04ea4002/Tie/Hash/NamedCapture.pm%#line 1 "/usr/lib/perl5/5.12.2/Tie/Hash/NamedCapture.pm" package Tie::Hash::NamedCapture; our $VERSION = "0.06"; # The real meat implemented in XS in universal.c in the core, but this # method was left behind because gv.c expects a Purl-Perl method in # this package when it loads the tie magic for %+ and %- my ($one, $all) = Tie::Hash::NamedCapture::flags(); sub TIEHASH { my ($pkg, %arg) = @_; my $flag = $arg{all} ? $all : $one; bless \$flag => $pkg; } tie %+, __PACKAGE__; tie %-, __PACKAGE__, all => 1; 1; __END__ #line 63 FILE5ef5ba7e/Time/Local.pm#line 1 "/usr/lib/perl5/5.12.2/Time/Local.pm" package Time::Local; require Exporter; use Carp; use Config; use strict; use vars qw( $VERSION @ISA @EXPORT @EXPORT_OK ); $VERSION = '1.1901_01'; @ISA = qw( Exporter ); @EXPORT = qw( timegm timelocal ); @EXPORT_OK = qw( timegm_nocheck timelocal_nocheck ); my @MonthDays = ( 31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31 ); # Determine breakpoint for rolling century my $ThisYear = ( localtime() )[5]; my $Breakpoint = ( $ThisYear + 50 ) % 100; my $NextCentury = $ThisYear - $ThisYear % 100; $NextCentury += 100 if $Breakpoint < 50; my $Century = $NextCentury - 100; my $SecOff = 0; my ( %Options, %Cheat ); use constant SECS_PER_MINUTE => 60; use constant SECS_PER_HOUR => 3600; use constant SECS_PER_DAY => 86400; # localtime()'s limit is the year 2**31 my $MaxDay = 365 * (2**31); # Determine the EPOC day for this machine my $Epoc = 0; if ( $^O eq 'vos' ) { # work around posix-977 -- VOS doesn't handle dates in the range # 1970-1980. $Epoc = _daygm( 0, 0, 0, 1, 0, 70, 4, 0 ); } elsif ( $^O eq 'MacOS' ) { $MaxDay *=2 if $^O eq 'MacOS'; # time_t unsigned ... quick hack? # MacOS time() is seconds since 1 Jan 1904, localtime # so we need to calculate an offset to apply later $Epoc = 693901; $SecOff = timelocal( localtime(0)) - timelocal( gmtime(0) ) ; $Epoc += _daygm( gmtime(0) ); } else { $Epoc = _daygm( gmtime(0) ); } %Cheat = (); # clear the cache as epoc has changed sub _daygm { # This is written in such a byzantine way in order to avoid # lexical variables and sub calls, for speed return $_[3] + ( $Cheat{ pack( 'ss', @_[ 4, 5 ] ) } ||= do { my $month = ( $_[4] + 10 ) % 12; my $year = $_[5] + 1900 - int($month / 10); ( ( 365 * $year ) + int( $year / 4 ) - int( $year / 100 ) + int( $year / 400 ) + int( ( ( $month * 306 ) + 5 ) / 10 ) ) - $Epoc; } ); } sub _timegm { my $sec = $SecOff + $_[0] + ( SECS_PER_MINUTE * $_[1] ) + ( SECS_PER_HOUR * $_[2] ); return $sec + ( SECS_PER_DAY * &_daygm ); } sub timegm { my ( $sec, $min, $hour, $mday, $month, $year ) = @_; if ( $year >= 1000 ) { $year -= 1900; } elsif ( $year < 100 and $year >= 0 ) { $year += ( $year > $Breakpoint ) ? $Century : $NextCentury; } unless ( $Options{no_range_check} ) { croak "Month '$month' out of range 0..11" if $month > 11 or $month < 0; my $md = $MonthDays[$month]; ++$md if $month == 1 && _is_leap_year( $year + 1900 ); croak "Day '$mday' out of range 1..$md" if $mday > $md or $mday < 1; croak "Hour '$hour' out of range 0..23" if $hour > 23 or $hour < 0; croak "Minute '$min' out of range 0..59" if $min > 59 or $min < 0; croak "Second '$sec' out of range 0..59" if $sec > 59 or $sec < 0; } my $days = _daygm( undef, undef, undef, $mday, $month, $year ); unless ($Options{no_range_check} or abs($days) < $MaxDay) { my $msg = ''; $msg .= "Day too big - $days > $MaxDay\n" if $days > $MaxDay; $year += 1900; $msg .= "Cannot handle date ($sec, $min, $hour, $mday, $month, $year)"; croak $msg; } return $sec + $SecOff + ( SECS_PER_MINUTE * $min ) + ( SECS_PER_HOUR * $hour ) + ( SECS_PER_DAY * $days ); } sub _is_leap_year { return 0 if $_[0] % 4; return 1 if $_[0] % 100; return 0 if $_[0] % 400; return 1; } sub timegm_nocheck { local $Options{no_range_check} = 1; return &timegm; } sub timelocal { my $ref_t = &timegm; my $loc_for_ref_t = _timegm( localtime($ref_t) ); my $zone_off = $loc_for_ref_t - $ref_t or return $loc_for_ref_t; # Adjust for timezone my $loc_t = $ref_t - $zone_off; # Are we close to a DST change or are we done my $dst_off = $ref_t - _timegm( localtime($loc_t) ); # If this evaluates to true, it means that the value in $loc_t is # the _second_ hour after a DST change where the local time moves # backward. if ( ! $dst_off && ( ( $ref_t - SECS_PER_HOUR ) - _timegm( localtime( $loc_t - SECS_PER_HOUR ) ) < 0 ) ) { return $loc_t - SECS_PER_HOUR; } # Adjust for DST change $loc_t += $dst_off; return $loc_t if $dst_off > 0; # If the original date was a non-extent gap in a forward DST jump, # we should now have the wrong answer - undo the DST adjustment my ( $s, $m, $h ) = localtime($loc_t); $loc_t -= $dst_off if $s != $_[0] || $m != $_[1] || $h != $_[2]; return $loc_t; } sub timelocal_nocheck { local $Options{no_range_check} = 1; return &timelocal; } 1; __END__ #line 342 FILEd0ec8e74/UNIVERSAL.pm#line 1 "/usr/lib/perl5/5.12.2/UNIVERSAL.pm" package UNIVERSAL; our $VERSION = '1.06'; # UNIVERSAL should not contain any extra subs/methods beyond those # that it exists to define. The use of Exporter below is a historical # accident that can't be fixed without breaking code. Note that we # *don't* set @ISA here, as we don't want all classes/objects inheriting from # Exporter. It's bad enough that all classes have a import() method # whenever UNIVERSAL.pm is loaded. require Exporter; @EXPORT_OK = qw(isa can VERSION); # Make sure that even though the import method is called, it doesn't do # anything unless called on UNIVERSAL. sub import { return unless $_[0] eq __PACKAGE__; return unless @_ > 1; require warnings; warnings::warnif( 'deprecated', 'UNIVERSAL->import is deprecated and will be removed in a future perl', ); goto &Exporter::import; } 1; __END__ #line 215 FILE571e1b5c/XSLoader.pm #line 1 "/usr/lib/perl5/5.12.2/XSLoader.pm" # Generated from XSLoader.pm.PL (resolved %Config::Config value) package XSLoader; $VERSION = "0.10"; #use strict; # enable debug/trace messages from DynaLoader perl code # $dl_debug = $ENV{PERL_DL_DEBUG} || 0 unless defined $dl_debug; my $dl_dlext = 'so'; package DynaLoader; # No prizes for guessing why we don't say 'bootstrap DynaLoader;' here. # NOTE: All dl_*.xs (including dl_none.xs) define a dl_error() XSUB boot_DynaLoader('DynaLoader') if defined(&boot_DynaLoader) && !defined(&dl_error); package XSLoader; sub load { package DynaLoader; die q{XSLoader::load('Your::Module', $Your::Module::VERSION)} unless @_; my($module) = $_[0]; # work with static linking too my $boots = "$module\::bootstrap"; goto &$boots if defined &$boots; goto retry; my @modparts = split(/::/,$module); my $modfname = $modparts[-1]; my $modpname = join('/',@modparts); my $modlibname = (caller())[1]; my $c = @modparts; $modlibname =~ s,[\\/][^\\/]+$,, while $c--; # Q&D basename my $file = "$modlibname/auto/$modpname/$modfname.$dl_dlext"; # print STDERR "XSLoader::load for $module ($file)\n" if $dl_debug; my $bs = $file; $bs =~ s/(\.\w+)?(;\d*)?$/\.bs/; # look for .bs 'beside' the library if (-s $bs) { # only read file if it's not empty # print STDERR "BS: $bs ($^O, $dlsrc)\n" if $dl_debug; eval { do $bs; }; warn "$bs: $@\n" if $@; } goto retry if not -f $file or -s $bs; my $bootname = "boot_$module"; $bootname =~ s/\W/_/g; @DynaLoader::dl_require_symbols = ($bootname); my $boot_symbol_ref; # Many dynamic extension loading problems will appear to come from # this section of code: XYZ failed at line 123 of DynaLoader.pm. # Often these errors are actually occurring in the initialisation # C code of the extension XS file. Perl reports the error as being # in this perl code simply because this was the last perl code # it executed. my $libref = dl_load_file($file, 0) or do { require Carp; Carp::croak("Can't load '$file' for module $module: " . dl_error()); }; push(@DynaLoader::dl_librefs,$libref); # record loaded object my @unresolved = dl_undef_symbols(); if (@unresolved) { require Carp; Carp::carp("Undefined symbols present after loading $file: @unresolved\n"); } $boot_symbol_ref = dl_find_symbol($libref, $bootname) or do { require Carp; Carp::croak("Can't find '$bootname' symbol in $file\n"); }; push(@DynaLoader::dl_modules, $module); # record loaded module boot: my $xs = dl_install_xsub($boots, $boot_symbol_ref, $file); # See comment block above push(@DynaLoader::dl_shared_objects, $file); # record files loaded return &$xs(@_); retry: my $bootstrap_inherit = DynaLoader->can('bootstrap_inherit') || XSLoader->can('bootstrap_inherit'); goto &$bootstrap_inherit; } # Versions of DynaLoader prior to 5.6.0 don't have this function. sub bootstrap_inherit { package DynaLoader; my $module = $_[0]; local *DynaLoader::isa = *{"$module\::ISA"}; local @DynaLoader::isa = (@DynaLoader::isa, 'DynaLoader'); # Cannot goto due to delocalization. Will report errors on a wrong line? require DynaLoader; DynaLoader::bootstrap(@_); } 1; __END__ #line 359 FILE93d93d57/base.pmI#line 1 "/usr/lib/perl5/5.12.2/base.pm" package base; use strict 'vars'; use vars qw($VERSION); $VERSION = '2.15'; $VERSION = eval $VERSION; # constant.pm is slow sub SUCCESS () { 1 } sub PUBLIC () { 2**0 } sub PRIVATE () { 2**1 } sub INHERITED () { 2**2 } sub PROTECTED () { 2**3 } my $Fattr = \%fields::attr; sub has_fields { my($base) = shift; my $fglob = ${"$base\::"}{FIELDS}; return( ($fglob && 'GLOB' eq ref($fglob) && *$fglob{HASH}) ? 1 : 0 ); } sub has_version { my($base) = shift; my $vglob = ${$base.'::'}{VERSION}; return( ($vglob && *$vglob{SCALAR}) ? 1 : 0 ); } sub has_attr { my($proto) = shift; my($class) = ref $proto || $proto; return exists $Fattr->{$class}; } sub get_attr { $Fattr->{$_[0]} = [1] unless $Fattr->{$_[0]}; return $Fattr->{$_[0]}; } if ($] < 5.009) { *get_fields = sub { # Shut up a possible typo warning. () = \%{$_[0].'::FIELDS'}; my $f = \%{$_[0].'::FIELDS'}; # should be centralized in fields? perhaps # fields::mk_FIELDS_be_OK. Peh. As long as %{ $package . '::FIELDS' } # is used here anyway, it doesn't matter. bless $f, 'pseudohash' if (ref($f) ne 'pseudohash'); return $f; } } else { *get_fields = sub { # Shut up a possible typo warning. () = \%{$_[0].'::FIELDS'}; return \%{$_[0].'::FIELDS'}; } } sub import { my $class = shift; return SUCCESS unless @_; # List of base classes from which we will inherit %FIELDS. my $fields_base; my $inheritor = caller(0); my @isa_classes; my @bases; foreach my $base (@_) { if ( $inheritor eq $base ) { warn "Class '$inheritor' tried to inherit from itself\n"; } next if grep $_->isa($base), ($inheritor, @bases); if (has_version($base)) { ${$base.'::VERSION'} = '-1, set by base.pm' unless defined ${$base.'::VERSION'}; } else { my $sigdie; { local $SIG{__DIE__}; eval "require $base"; # Only ignore "Can't locate" errors from our eval require. # Other fatal errors (syntax etc) must be reported. die if $@ && $@ !~ /^Can't locate .*? at \(eval /; unless (%{"$base\::"}) { require Carp; local $" = " "; Carp::croak(<[0] = @$battr; if( keys %$dfields ) { warn <<"END"; $derived is inheriting from $base but already has its own fields! This will cause problems. Be sure you use base BEFORE declaring fields. END } # Iterate through the base's fields adding all the non-private # ones to the derived class. Hang on to the original attribute # (Public, Private, etc...) and add Inherited. # This is all too complicated to do efficiently with add_fields(). while (my($k,$v) = each %$bfields) { my $fno; if ($fno = $dfields->{$k} and $fno != $v) { require Carp; Carp::croak ("Inherited fields can't override existing fields"); } if( $battr->[$v] & PRIVATE ) { $dattr->[$v] = PRIVATE | INHERITED; } else { $dattr->[$v] = INHERITED | $battr->[$v]; $dfields->{$k} = $v; } } foreach my $idx (1..$#{$battr}) { next if defined $dattr->[$idx]; $dattr->[$idx] = $battr->[$idx] & INHERITED; } } 1; __END__ #line 266 FILE2883d969/bytes.pm#line 1 "/usr/lib/perl5/5.12.2/bytes.pm" package bytes; our $VERSION = '1.04'; $bytes::hint_bits = 0x00000008; sub import { $^H |= $bytes::hint_bits; } sub unimport { $^H &= ~$bytes::hint_bits; } sub AUTOLOAD { require "bytes_heavy.pl"; goto &$AUTOLOAD if defined &$AUTOLOAD; require Carp; Carp::croak("Undefined subroutine $AUTOLOAD called"); } sub length (_); sub chr (_); sub ord (_); sub substr ($$;$$); sub index ($$;$); sub rindex ($$;$); 1; __END__ #line 101 FILEfba67960/constant.pm#line 1 "/usr/lib/perl5/5.12.2/constant.pm" package constant; use 5.005; use strict; use warnings::register; use vars qw($VERSION %declared); $VERSION = '1.20'; #======================================================================= # Some names are evil choices. my %keywords = map +($_, 1), qw{ BEGIN INIT CHECK END DESTROY AUTOLOAD }; $keywords{UNITCHECK}++ if $] > 5.009; my %forced_into_main = map +($_, 1), qw{ STDIN STDOUT STDERR ARGV ARGVOUT ENV INC SIG }; my %forbidden = (%keywords, %forced_into_main); my $str_end = $] >= 5.006 ? "\\z" : "\\Z"; my $normal_constant_name = qr/^_?[^\W_0-9]\w*$str_end/; my $tolerable = qr/^[A-Za-z_]\w*$str_end/; my $boolean = qr/^[01]?$str_end/; BEGIN { # We'd like to do use constant _CAN_PCS => $] > 5.009002 # but that's a bit tricky before we load the constant module :-) # By doing this, we save 1 run time check for *every* call to import. no strict 'refs'; my $const = $] > 5.009002; *_CAN_PCS = sub () {$const}; } #======================================================================= # import() - import symbols into user's namespace # # What we actually do is define a function in the caller's namespace # which returns the value. The function we create will normally # be inlined as a constant, thereby avoiding further sub calling # overhead. #======================================================================= sub import { my $class = shift; return unless @_; # Ignore 'use constant;' my $constants; my $multiple = ref $_[0]; my $pkg = caller; my $flush_mro; my $symtab; if (_CAN_PCS) { no strict 'refs'; $symtab = \%{$pkg . '::'}; }; if ( $multiple ) { if (ref $_[0] ne 'HASH') { require Carp; Carp::croak("Invalid reference type '".ref(shift)."' not 'HASH'"); } $constants = shift; } else { unless (defined $_[0]) { require Carp; Carp::croak("Can't use undef as constant name"); } $constants->{+shift} = undef; } foreach my $name ( keys %$constants ) { # Normal constant name if ($name =~ $normal_constant_name and !$forbidden{$name}) { # Everything is okay # Name forced into main, but we're not in main. Fatal. } elsif ($forced_into_main{$name} and $pkg ne 'main') { require Carp; Carp::croak("Constant name '$name' is forced into main::"); # Starts with double underscore. Fatal. } elsif ($name =~ /^__/) { require Carp; Carp::croak("Constant name '$name' begins with '__'"); # Maybe the name is tolerable } elsif ($name =~ $tolerable) { # Then we'll warn only if you've asked for warnings if (warnings::enabled()) { if ($keywords{$name}) { warnings::warn("Constant name '$name' is a Perl keyword"); } elsif ($forced_into_main{$name}) { warnings::warn("Constant name '$name' is " . "forced into package main::"); } } # Looks like a boolean # use constant FRED == fred; } elsif ($name =~ $boolean) { require Carp; if (@_) { Carp::croak("Constant name '$name' is invalid"); } else { Carp::croak("Constant name looks like boolean value"); } } else { # Must have bad characters require Carp; Carp::croak("Constant name '$name' has invalid characters"); } { no strict 'refs'; my $full_name = "${pkg}::$name"; $declared{$full_name}++; if ($multiple || @_ == 1) { my $scalar = $multiple ? $constants->{$name} : $_[0]; # The constant serves to optimise this entire block out on # 5.8 and earlier. if (_CAN_PCS && $symtab && !exists $symtab->{$name}) { # No typeglob yet, so we can use a reference as space- # efficient proxy for a constant subroutine # The check in Perl_ck_rvconst knows that inlinable # constants from cv_const_sv are read only. So we have to: Internals::SvREADONLY($scalar, 1); $symtab->{$name} = \$scalar; ++$flush_mro; } else { *$full_name = sub () { $scalar }; } } elsif (@_) { my @list = @_; *$full_name = sub () { @list }; } else { *$full_name = sub () { }; } } } # Flush the cache exactly once if we make any direct symbol table changes. mro::method_changed_in($pkg) if _CAN_PCS && $flush_mro; } 1; __END__ #line 392 FILE003cf4e7/Compress/Raw/Zlib.pm:#line 1 "/usr/lib/perl5/5.12.2/i686-linux/Compress/Raw/Zlib.pm" package Compress::Raw::Zlib; require 5.004 ; require Exporter; use AutoLoader; use Carp ; #use Parse::Parameters; use strict ; use warnings ; use bytes ; our ($VERSION, $XS_VERSION, @ISA, @EXPORT, $AUTOLOAD); $VERSION = '2.024'; $XS_VERSION = $VERSION; $VERSION = eval $VERSION; @ISA = qw(Exporter); # Items to export into callers namespace by default. Note: do not export # names by default without a very good reason. Use EXPORT_OK instead. # Do not simply export all your public functions/methods/constants. @EXPORT = qw( adler32 crc32 ZLIB_VERSION ZLIB_VERNUM DEF_WBITS OS_CODE MAX_MEM_LEVEL MAX_WBITS Z_ASCII Z_BEST_COMPRESSION Z_BEST_SPEED Z_BINARY Z_BLOCK Z_BUF_ERROR Z_DATA_ERROR Z_DEFAULT_COMPRESSION Z_DEFAULT_STRATEGY Z_DEFLATED Z_ERRNO Z_FILTERED Z_FIXED Z_FINISH Z_FULL_FLUSH Z_HUFFMAN_ONLY Z_MEM_ERROR Z_NEED_DICT Z_NO_COMPRESSION Z_NO_FLUSH Z_NULL Z_OK Z_PARTIAL_FLUSH Z_RLE Z_STREAM_END Z_STREAM_ERROR Z_SYNC_FLUSH Z_UNKNOWN Z_VERSION_ERROR WANT_GZIP WANT_GZIP_OR_ZLIB ); use constant WANT_GZIP => 16; use constant WANT_GZIP_OR_ZLIB => 32; sub AUTOLOAD { my($constname); ($constname = $AUTOLOAD) =~ s/.*:://; my ($error, $val) = constant($constname); Carp::croak $error if $error; no strict 'refs'; *{$AUTOLOAD} = sub { $val }; goto &{$AUTOLOAD}; } use constant FLAG_APPEND => 1 ; use constant FLAG_CRC => 2 ; use constant FLAG_ADLER => 4 ; use constant FLAG_CONSUME_INPUT => 8 ; use constant FLAG_LIMIT_OUTPUT => 16 ; eval { require XSLoader; XSLoader::load('Compress::Raw::Zlib', $XS_VERSION); 1; } or do { require DynaLoader; local @ISA = qw(DynaLoader); bootstrap Compress::Raw::Zlib $XS_VERSION ; }; use constant Parse_any => 0x01; use constant Parse_unsigned => 0x02; use constant Parse_signed => 0x04; use constant Parse_boolean => 0x08; use constant Parse_string => 0x10; use constant Parse_custom => 0x12; use constant Parse_store_ref => 0x100 ; use constant OFF_PARSED => 0 ; use constant OFF_TYPE => 1 ; use constant OFF_DEFAULT => 2 ; use constant OFF_FIXED => 3 ; use constant OFF_FIRST_ONLY => 4 ; use constant OFF_STICKY => 5 ; sub ParseParameters { my $level = shift || 0 ; my $sub = (caller($level + 1))[3] ; #local $Carp::CarpLevel = 1 ; my $p = new Compress::Raw::Zlib::Parameters() ; $p->parse(@_) or croak "$sub: $p->{Error}" ; return $p; } sub Compress::Raw::Zlib::Parameters::new { my $class = shift ; my $obj = { Error => '', Got => {}, } ; #return bless $obj, ref($class) || $class || __PACKAGE__ ; return bless $obj, 'Compress::Raw::Zlib::Parameters' ; } sub Compress::Raw::Zlib::Parameters::setError { my $self = shift ; my $error = shift ; my $retval = @_ ? shift : undef ; $self->{Error} = $error ; return $retval; } #sub getError #{ # my $self = shift ; # return $self->{Error} ; #} sub Compress::Raw::Zlib::Parameters::parse { my $self = shift ; my $default = shift ; my $got = $self->{Got} ; my $firstTime = keys %{ $got } == 0 ; my (@Bad) ; my @entered = () ; # Allow the options to be passed as a hash reference or # as the complete hash. if (@_ == 0) { @entered = () ; } elsif (@_ == 1) { my $href = $_[0] ; return $self->setError("Expected even number of parameters, got 1") if ! defined $href or ! ref $href or ref $href ne "HASH" ; foreach my $key (keys %$href) { push @entered, $key ; push @entered, \$href->{$key} ; } } else { my $count = @_; return $self->setError("Expected even number of parameters, got $count") if $count % 2 != 0 ; for my $i (0.. $count / 2 - 1) { push @entered, $_[2* $i] ; push @entered, \$_[2* $i+1] ; } } while (my ($key, $v) = each %$default) { croak "need 4 params [@$v]" if @$v != 4 ; my ($first_only, $sticky, $type, $value) = @$v ; my $x ; $self->_checkType($key, \$value, $type, 0, \$x) or return undef ; $key = lc $key; if ($firstTime || ! $sticky) { $got->{$key} = [0, $type, $value, $x, $first_only, $sticky] ; } $got->{$key}[OFF_PARSED] = 0 ; } for my $i (0.. @entered / 2 - 1) { my $key = $entered[2* $i] ; my $value = $entered[2* $i+1] ; #print "Key [$key] Value [$value]" ; #print defined $$value ? "[$$value]\n" : "[undef]\n"; $key =~ s/^-// ; my $canonkey = lc $key; if ($got->{$canonkey} && ($firstTime || ! $got->{$canonkey}[OFF_FIRST_ONLY] )) { my $type = $got->{$canonkey}[OFF_TYPE] ; my $s ; $self->_checkType($key, $value, $type, 1, \$s) or return undef ; #$value = $$value unless $type & Parse_store_ref ; $value = $$value ; $got->{$canonkey} = [1, $type, $value, $s] ; } else { push (@Bad, $key) } } if (@Bad) { my ($bad) = join(", ", @Bad) ; return $self->setError("unknown key value(s) @Bad") ; } return 1; } sub Compress::Raw::Zlib::Parameters::_checkType { my $self = shift ; my $key = shift ; my $value = shift ; my $type = shift ; my $validate = shift ; my $output = shift; #local $Carp::CarpLevel = $level ; #print "PARSE $type $key $value $validate $sub\n" ; if ( $type & Parse_store_ref) { #$value = $$value # if ref ${ $value } ; $$output = $value ; return 1; } $value = $$value ; if ($type & Parse_any) { $$output = $value ; return 1; } elsif ($type & Parse_unsigned) { return $self->setError("Parameter '$key' must be an unsigned int, got 'undef'") if $validate && ! defined $value ; return $self->setError("Parameter '$key' must be an unsigned int, got '$value'") if $validate && $value !~ /^\d+$/; $$output = defined $value ? $value : 0 ; return 1; } elsif ($type & Parse_signed) { return $self->setError("Parameter '$key' must be a signed int, got 'undef'") if $validate && ! defined $value ; return $self->setError("Parameter '$key' must be a signed int, got '$value'") if $validate && $value !~ /^-?\d+$/; $$output = defined $value ? $value : 0 ; return 1 ; } elsif ($type & Parse_boolean) { return $self->setError("Parameter '$key' must be an int, got '$value'") if $validate && defined $value && $value !~ /^\d*$/; $$output = defined $value ? $value != 0 : 0 ; return 1; } elsif ($type & Parse_string) { $$output = defined $value ? $value : "" ; return 1; } $$output = $value ; return 1; } sub Compress::Raw::Zlib::Parameters::parsed { my $self = shift ; my $name = shift ; return $self->{Got}{lc $name}[OFF_PARSED] ; } sub Compress::Raw::Zlib::Parameters::value { my $self = shift ; my $name = shift ; if (@_) { $self->{Got}{lc $name}[OFF_PARSED] = 1; $self->{Got}{lc $name}[OFF_DEFAULT] = $_[0] ; $self->{Got}{lc $name}[OFF_FIXED] = $_[0] ; } return $self->{Got}{lc $name}[OFF_FIXED] ; } sub Compress::Raw::Zlib::Deflate::new { my $pkg = shift ; my ($got) = ParseParameters(0, { 'AppendOutput' => [1, 1, Parse_boolean, 0], 'CRC32' => [1, 1, Parse_boolean, 0], 'ADLER32' => [1, 1, Parse_boolean, 0], 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'Level' => [1, 1, Parse_signed, Z_DEFAULT_COMPRESSION()], 'Method' => [1, 1, Parse_unsigned, Z_DEFLATED()], 'WindowBits' => [1, 1, Parse_signed, MAX_WBITS()], 'MemLevel' => [1, 1, Parse_unsigned, MAX_MEM_LEVEL()], 'Strategy' => [1, 1, Parse_unsigned, Z_DEFAULT_STRATEGY()], 'Dictionary' => [1, 1, Parse_any, ""], }, @_) ; croak "Compress::Raw::Zlib::Deflate::new: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $flags = 0 ; $flags |= FLAG_APPEND if $got->value('AppendOutput') ; $flags |= FLAG_CRC if $got->value('CRC32') ; $flags |= FLAG_ADLER if $got->value('ADLER32') ; my $windowBits = $got->value('WindowBits'); $windowBits += MAX_WBITS() if ($windowBits & MAX_WBITS()) == 0 ; _deflateInit($flags, $got->value('Level'), $got->value('Method'), $windowBits, $got->value('MemLevel'), $got->value('Strategy'), $got->value('Bufsize'), $got->value('Dictionary')) ; } sub Compress::Raw::Zlib::Inflate::new { my $pkg = shift ; my ($got) = ParseParameters(0, { 'AppendOutput' => [1, 1, Parse_boolean, 0], 'LimitOutput' => [1, 1, Parse_boolean, 0], 'CRC32' => [1, 1, Parse_boolean, 0], 'ADLER32' => [1, 1, Parse_boolean, 0], 'ConsumeInput' => [1, 1, Parse_boolean, 1], 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'WindowBits' => [1, 1, Parse_signed, MAX_WBITS()], 'Dictionary' => [1, 1, Parse_any, ""], }, @_) ; croak "Compress::Raw::Zlib::Inflate::new: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $flags = 0 ; $flags |= FLAG_APPEND if $got->value('AppendOutput') ; $flags |= FLAG_CRC if $got->value('CRC32') ; $flags |= FLAG_ADLER if $got->value('ADLER32') ; $flags |= FLAG_CONSUME_INPUT if $got->value('ConsumeInput') ; $flags |= FLAG_LIMIT_OUTPUT if $got->value('LimitOutput') ; my $windowBits = $got->value('WindowBits'); $windowBits += MAX_WBITS() if ($windowBits & MAX_WBITS()) == 0 ; _inflateInit($flags, $windowBits, $got->value('Bufsize'), $got->value('Dictionary')) ; } sub Compress::Raw::Zlib::InflateScan::new { my $pkg = shift ; my ($got) = ParseParameters(0, { 'CRC32' => [1, 1, Parse_boolean, 0], 'ADLER32' => [1, 1, Parse_boolean, 0], 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'WindowBits' => [1, 1, Parse_signed, -MAX_WBITS()], 'Dictionary' => [1, 1, Parse_any, ""], }, @_) ; croak "Compress::Raw::Zlib::InflateScan::new: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $flags = 0 ; #$flags |= FLAG_APPEND if $got->value('AppendOutput') ; $flags |= FLAG_CRC if $got->value('CRC32') ; $flags |= FLAG_ADLER if $got->value('ADLER32') ; #$flags |= FLAG_CONSUME_INPUT if $got->value('ConsumeInput') ; _inflateScanInit($flags, $got->value('WindowBits'), $got->value('Bufsize'), '') ; } sub Compress::Raw::Zlib::inflateScanStream::createDeflateStream { my $pkg = shift ; my ($got) = ParseParameters(0, { 'AppendOutput' => [1, 1, Parse_boolean, 0], 'CRC32' => [1, 1, Parse_boolean, 0], 'ADLER32' => [1, 1, Parse_boolean, 0], 'Bufsize' => [1, 1, Parse_unsigned, 4096], 'Level' => [1, 1, Parse_signed, Z_DEFAULT_COMPRESSION()], 'Method' => [1, 1, Parse_unsigned, Z_DEFLATED()], 'WindowBits' => [1, 1, Parse_signed, - MAX_WBITS()], 'MemLevel' => [1, 1, Parse_unsigned, MAX_MEM_LEVEL()], 'Strategy' => [1, 1, Parse_unsigned, Z_DEFAULT_STRATEGY()], }, @_) ; croak "Compress::Raw::Zlib::InflateScan::createDeflateStream: Bufsize must be >= 1, you specified " . $got->value('Bufsize') unless $got->value('Bufsize') >= 1; my $flags = 0 ; $flags |= FLAG_APPEND if $got->value('AppendOutput') ; $flags |= FLAG_CRC if $got->value('CRC32') ; $flags |= FLAG_ADLER if $got->value('ADLER32') ; $pkg->_createDeflateStream($flags, $got->value('Level'), $got->value('Method'), $got->value('WindowBits'), $got->value('MemLevel'), $got->value('Strategy'), $got->value('Bufsize'), ) ; } sub Compress::Raw::Zlib::inflateScanStream::inflate { my $self = shift ; my $buffer = $_[1]; my $eof = $_[2]; my $status = $self->scan(@_); if ($status == Z_OK() && $_[2]) { my $byte = ' '; $status = $self->scan(\$byte, $_[1]) ; } return $status ; } sub Compress::Raw::Zlib::deflateStream::deflateParams { my $self = shift ; my ($got) = ParseParameters(0, { 'Level' => [1, 1, Parse_signed, undef], 'Strategy' => [1, 1, Parse_unsigned, undef], 'Bufsize' => [1, 1, Parse_unsigned, undef], }, @_) ; croak "Compress::Raw::Zlib::deflateParams needs Level and/or Strategy" unless $got->parsed('Level') + $got->parsed('Strategy') + $got->parsed('Bufsize'); croak "Compress::Raw::Zlib::Inflate::deflateParams: Bufsize must be >= 1, you specified " . $got->value('Bufsize') if $got->parsed('Bufsize') && $got->value('Bufsize') <= 1; my $flags = 0; $flags |= 1 if $got->parsed('Level') ; $flags |= 2 if $got->parsed('Strategy') ; $flags |= 4 if $got->parsed('Bufsize') ; $self->_deflateParams($flags, $got->value('Level'), $got->value('Strategy'), $got->value('Bufsize')); } # Autoload methods go after __END__, and are processed by the autosplit program. 1; __END__ #line 1420 FILE70f95a97/Config.pm =#line 1 "/usr/lib/perl5/5.12.2/i686-linux/Config.pm" # This file was created by configpm when Perl was built. Any changes # made to this file will be lost the next time perl is built. # for a description of the variables, please have a look at the # Glossary file, as written in the Porting folder, or use the url: # http://perl5.git.perl.org/perl.git/blob/HEAD:/Porting/Glossary package Config; use strict; # use warnings; Pulls in Carp # use vars pulls in Carp @Config::EXPORT = qw(%Config); @Config::EXPORT_OK = qw(myconfig config_sh config_vars config_re); # Need to stub all the functions to make code such as print Config::config_sh # keep working sub myconfig; sub config_sh; sub config_vars; sub config_re; my %Export_Cache = map {($_ => 1)} (@Config::EXPORT, @Config::EXPORT_OK); our %Config; # Define our own import method to avoid pulling in the full Exporter: sub import { my $pkg = shift; @_ = @Config::EXPORT unless @_; my @funcs = grep $_ ne '%Config', @_; my $export_Config = @funcs < @_ ? 1 : 0; no strict 'refs'; my $callpkg = caller(0); foreach my $func (@funcs) { die sprintf qq{"%s" is not exported by the %s module\n}, $func, __PACKAGE__ unless $Export_Cache{$func}; *{$callpkg.'::'.$func} = \&{$func}; } *{"$callpkg\::Config"} = \%Config if $export_Config; return; } die "Perl lib version (5.12.2) doesn't match executable version ($])" unless $^V; $^V eq 5.12.2 or die "Perl lib version (5.12.2) doesn't match executable version (" . sprintf("v%vd",$^V) . ")"; sub FETCH { my($self, $key) = @_; # check for cached value (which may be undef so we use exists not defined) return $self->{$key} if exists $self->{$key}; return $self->fetch_string($key); } sub TIEHASH { bless $_[1], $_[0]; } sub DESTROY { } sub AUTOLOAD { require 'Config_heavy.pl'; goto \&launcher unless $Config::AUTOLOAD =~ /launcher$/; die "&Config::AUTOLOAD failed on $Config::AUTOLOAD"; } # tie returns the object, so the value returned to require will be true. tie %Config, 'Config', { archlibexp => '/usr/lib/perl5/5.12.2/i686-linux', archname => 'i686-linux', cc => 'i686-pc-linux-gnu-gcc', d_readlink => 'define', d_symlink => 'define', dlsrc => 'dl_dlopen.xs', dont_use_nlink => undef, exe_ext => '', inc_version_list => '5.12.1/i686-linux 5.12.1 5.12.0/i686-linux 5.12.0 ', intsize => '4', ldlibpthname => 'LD_LIBRARY_PATH', libpth => '/usr/local/lib /lib /usr/lib', osname => 'linux', osvers => '2.6.35-gentoo-r12', path_sep => ':', privlibexp => '/usr/lib/perl5/5.12.2', scriptdir => '/usr/bin', sitearchexp => '/usr/lib/perl5/site_perl/5.12.2/i686-linux', sitelibexp => '/usr/lib/perl5/site_perl/5.12.2', useithreads => undef, usevendorprefix => 'define', version => '5.12.2', }; FILEc33fbebe/Config_git.pl###################################################################### # WARNING: 'lib/Config_git.pl' is generated by make_patchnum.pl # DO NOT EDIT DIRECTLY - edit make_patchnum.pl instead ###################################################################### $Config::Git_Data=<<'ENDOFGIT'; git_commit_id='' git_describe='' git_branch='' git_uncommitted_changes='' git_commit_id_title='' ENDOFGIT FILEa2b8781d/Config_heavy.pl# This file was created by configpm when Perl was built. Any changes # made to this file will be lost the next time perl is built. package Config; use strict; # use warnings; Pulls in Carp # use vars pulls in Carp sub _V { my ($bincompat, $non_bincompat, $date, @patches) = Internals::V(); my $opts = join ' ', sort split ' ', "$bincompat $non_bincompat"; # wrap at 76 columns. $opts =~ s/(?=.{53})(.{1,53}) /$1\n /mg; print Config::myconfig(); if ($^O eq 'VMS') { print "\nCharacteristics of this PERLSHR image: \n"; } else { print "\nCharacteristics of this binary (from libperl): \n"; } print " Compile-time options: $opts\n"; if (@patches) { print " Locally applied patches:\n"; print "\t$_\n" foreach @patches; } print " Built under $^O\n"; print " $date\n" if defined $date; my @env = map { "$_=\"$ENV{$_}\"" } sort grep {/^PERL/} keys %ENV; push @env, "CYGWIN=\"$ENV{CYGWIN}\"" if $^O eq 'cygwin'; if (@env) { print " \%ENV:\n"; print " $_\n" foreach @env; } print " \@INC:\n"; print " $_\n" foreach @INC; } ## ## This file was produced by running the Configure script. It holds all the ## definitions figured out by Configure. Should you modify one of these values, ## do not forget to propagate your changes by running "Configure -der". You may ## instead choose to run each of the .SH files by yourself, or "Configure -S". ## # ## Package name : perl5 ## Source directory : . ## Configuration time: Thu Dec 9 11:02:39 EST 2010 ## Configured by : Gentoo ## Target system : linux data.wks.liquidweb.com 2.6.35-gentoo-r12 #4 smp thu dec 9 10:47:59 est 2010 i686 pentium(r) dual-core cpu e5400 @ 2.70ghz genuineintel gnulinux # #: Configure command line arguments. # #: Variables propagated from previous config.sh file. our $summary = <<'!END!'; Summary of my $package (revision $revision $version_patchlevel_string) configuration: $git_commit_id_title $git_commit_id$git_ancestor_line Platform: osname=$osname, osvers=$osvers, archname=$archname uname='$myuname' config_args='$config_args' hint=$hint, useposix=$useposix, d_sigaction=$d_sigaction useithreads=$useithreads, usemultiplicity=$usemultiplicity useperlio=$useperlio, d_sfio=$d_sfio, uselargefiles=$uselargefiles, usesocks=$usesocks use64bitint=$use64bitint, use64bitall=$use64bitall, uselongdouble=$uselongdouble usemymalloc=$usemymalloc, bincompat5005=undef Compiler: cc='$cc', ccflags ='$ccflags', optimize='$optimize', cppflags='$cppflags' ccversion='$ccversion', gccversion='$gccversion', gccosandvers='$gccosandvers' intsize=$intsize, longsize=$longsize, ptrsize=$ptrsize, doublesize=$doublesize, byteorder=$byteorder d_longlong=$d_longlong, longlongsize=$longlongsize, d_longdbl=$d_longdbl, longdblsize=$longdblsize ivtype='$ivtype', ivsize=$ivsize, nvtype='$nvtype', nvsize=$nvsize, Off_t='$lseektype', lseeksize=$lseeksize alignbytes=$alignbytes, prototype=$prototype Linker and Libraries: ld='$ld', ldflags ='$ldflags' libpth=$libpth libs=$libs perllibs=$perllibs libc=$libc, so=$so, useshrplib=$useshrplib, libperl=$libperl gnulibc_version='$gnulibc_version' Dynamic Linking: dlsrc=$dlsrc, dlext=$dlext, d_dlsymun=$d_dlsymun, ccdlflags='$ccdlflags' cccdlflags='$cccdlflags', lddlflags='$lddlflags' !END! my $summary_expanded; sub myconfig { return $summary_expanded if $summary_expanded; ($summary_expanded = $summary) =~ s{\$(\w+)} { my $c; if ($1 eq 'git_ancestor_line') { if ($Config::Config{git_ancestor}) { $c= "\n Ancestor: $Config::Config{git_ancestor}"; } else { $c= ""; } } else { $c = $Config::Config{$1}; } defined($c) ? $c : 'undef' }ge; $summary_expanded; } local *_ = \my $a; $_ = <<'!END!'; Author='' CONFIG='true' Date='$Date' Header='' Id='$Id' Locker='' Log='$Log' PATCHLEVEL='12' PERL_API_REVISION='5' PERL_API_SUBVERSION='0' PERL_API_VERSION='12' PERL_CONFIG_SH='true' PERL_PATCHLEVEL='' PERL_REVISION='5' PERL_SUBVERSION='2' PERL_VERSION='12' RCSfile='$RCSfile' Revision='$Revision' SUBVERSION='2' Source='' State='' _a='.a' _exe='' _o='.o' afs='false' afsroot='/afs' alignbytes='4' ansi2knr='' aphostname='' api_revision='5' api_subversion='0' api_version='12' api_versionstring='5.12.0' ar='ar' archlib='/usr/lib/perl5/5.12.2/i686-linux' archlibexp='/usr/lib/perl5/5.12.2/i686-linux' archname64='' archname='i686-linux' archobjs='' asctime_r_proto='0' awk='awk' baserev='5.0' bash='' bin='/usr/bin' bin_ELF='define' binexp='/usr/bin' bison='bison' byacc='byacc' byteorder='1234' c='' castflags='0' cat='cat' cc='i686-pc-linux-gnu-gcc' cccdlflags='-fPIC' ccdlflags='-Wl,-E' ccflags='-fno-strict-aliasing -pipe -fstack-protector -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64' ccflags_uselargefiles='-D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64' ccname='gcc' ccsymbols='' ccversion='' cf_by='Gentoo' cf_email='Gentoo@localhost.localdomain' cf_time='Thu Dec 9 11:02:39 EST 2010' charbits='8' charsize='1' chgrp='' chmod='chmod' chown='' clocktype='clock_t' comm='comm' compress='' config_arg0='Configure' config_arg10='-Dscriptdir=/usr/bin' config_arg11='-Dprivlib=/usr/lib/perl5/5.12.2' config_arg12='-Darchlib=/usr/lib/perl5/5.12.2/i686-linux' config_arg13='-Dsitelib=/usr/lib/perl5/site_perl/5.12.2' config_arg14='-Dsitearch=/usr/lib/perl5/site_perl/5.12.2/i686-linux' config_arg15='-Dvendorlib=/usr/lib/perl5/vendor_perl/5.12.2' config_arg16='-Dvendorarch=/usr/lib/perl5/vendor_perl/5.12.2/i686-linux' config_arg17='-Dman1dir=/usr/share/man/man1' config_arg18='-Dman3dir=/usr/share/man/man3' config_arg19='-Dsiteman1dir=/usr/share/man/man1' config_arg1='-des' config_arg20='-Dsiteman3dir=/usr/share/man/man3' config_arg21='-Dvendorman1dir=/usr/share/man/man1' config_arg22='-Dvendorman3dir=/usr/share/man/man3' config_arg23='-Dman1ext=1' config_arg24='-Dman3ext=3pm' config_arg25='-Dlibperl=libperl.so.5.12.2' config_arg26='-Dlocincpth= ' config_arg27='-Duselargefiles' config_arg28='-Dd_semctl_semun' config_arg29='-Dcf_by=Gentoo' config_arg2='-Duseshrplib' config_arg30='-Dmyhostname=localhost' config_arg31='-Dperladmin=root@localhost' config_arg32='-Dinstallusrbinperl=n' config_arg33='-Ud_csh' config_arg34='-Uusenm' config_arg35='-Di_ndbm' config_arg36='-Di_gdbm' config_arg37='-Di_db' config_arg38='-DDEBUGGING=none' config_arg39='-Dinc_version_list=5.12.1/i686-linux 5.12.1 5.12.0/i686-linux 5.12.0 ' config_arg3='-Darchname=i686-linux' config_arg4='-Dcc=i686-pc-linux-gnu-gcc' config_arg5='-Doptimize=-O2 -march=i686 -pipe' config_arg6='-Dldflags=-Wl,-O1 -Wl,--as-needed' config_arg7='-Dprefix=/usr' config_arg8='-Dsiteprefix=/usr' config_arg9='-Dvendorprefix=/usr' config_argc='39' config_args='-des -Duseshrplib -Darchname=i686-linux -Dcc=i686-pc-linux-gnu-gcc -Doptimize=-O2 -march=i686 -pipe -Dldflags=-Wl,-O1 -Wl,--as-needed -Dprefix=/usr -Dsiteprefix=/usr -Dvendorprefix=/usr -Dscriptdir=/usr/bin -Dprivlib=/usr/lib/perl5/5.12.2 -Darchlib=/usr/lib/perl5/5.12.2/i686-linux -Dsitelib=/usr/lib/perl5/site_perl/5.12.2 -Dsitearch=/usr/lib/perl5/site_perl/5.12.2/i686-linux -Dvendorlib=/usr/lib/perl5/vendor_perl/5.12.2 -Dvendorarch=/usr/lib/perl5/vendor_perl/5.12.2/i686-linux -Dman1dir=/usr/share/man/man1 -Dman3dir=/usr/share/man/man3 -Dsiteman1dir=/usr/share/man/man1 -Dsiteman3dir=/usr/share/man/man3 -Dvendorman1dir=/usr/share/man/man1 -Dvendorman3dir=/usr/share/man/man3 -Dman1ext=1 -Dman3ext=3pm -Dlibperl=libperl.so.5.12.2 -Dlocincpth= -Duselargefiles -Dd_semctl_semun -Dcf_by=Gentoo -Dmyhostname=localhost -Dperladmin=root@localhost -Dinstallusrbinperl=n -Ud_csh -Uusenm -Di_ndbm -Di_gdbm -Di_db -DDEBUGGING=none -Dinc_version_list=5.12.1/i686-linux 5.12.1 5.12.0/i686-linux 5.12.0 ' contains='grep' cp='cp' cpio='' cpp='cpp' cpp_stuff='42' cppccsymbols='_FORTIFY_SOURCE=2' cppflags='-fno-strict-aliasing -pipe -fstack-protector' cpplast='-' cppminus='-' cpprun='i686-pc-linux-gnu-gcc -E' cppstdin='i686-pc-linux-gnu-gcc -E' cppsymbols='_FILE_OFFSET_BITS=64 _LARGEFILE_SOURCE=1 _POSIX_C_SOURCE=200809L _POSIX_SOURCE=1 __BIGGEST_ALIGNMENT__=16 __CHAR16_TYPE__=short\ unsigned\ int __CHAR32_TYPE__=unsigned\ int __CHAR_BIT__=8 __DBL_DENORM_MIN__=4.9406564584124654e-324 __DBL_DIG__=15 __DBL_EPSILON__=2.2204460492503131e-16 __DBL_HAS_DENORM__=1 __DBL_HAS_INFINITY__=1 __DBL_HAS_QUIET_NAN__=1 __DBL_MANT_DIG__=53 __DBL_MAX_10_EXP__=308 __DBL_MAX_EXP__=1024 __DBL_MAX__=1.7976931348623157e+308 __DBL_MIN_10_EXP__=(-307) __DBL_MIN_EXP__=(-1021) __DBL_MIN__=2.2250738585072014e-308 __DEC128_EPSILON__=1E-33DL __DEC128_MANT_DIG__=34 __DEC128_MAX_EXP__=6145 __DEC128_MAX__=9.999999999999999999999999999999999E6144DL __DEC128_MIN_EXP__=(-6142) __DEC128_MIN__=1E-6143DL __DEC128_SUBNORMAL_MIN__=0.000000000000000000000000000000001E-6143DL __DEC32_EPSILON__=1E-6DF __DEC32_MANT_DIG__=7 __DEC32_MAX_EXP__=97 __DEC32_MAX__=9.999999E96DF __DEC32_MIN_EXP__=(-94) __DEC32_MIN__=1E-95DF __DEC32_SUBNORMAL_MIN__=0.000001E-95DF __DEC64_EPSILON__=1E-15DD __DEC64_MANT_DIG__=16 __DEC64_MAX_EXP__=385 __DEC64_MAX__=9.999999999999999E384DD __DEC64_MIN_EXP__=(-382) __DEC64_MIN__=1E-383DD __DEC64_SUBNORMAL_MIN__=0.000000000000001E-383DD __DECIMAL_BID_FORMAT__=1 __DECIMAL_DIG__=21 __DEC_EVAL_METHOD__=2 __ELF__=1 __FINITE_MATH_ONLY__=0 __FLT_DENORM_MIN__=1.40129846e-45F __FLT_DIG__=6 __FLT_EPSILON__=1.19209290e-7F __FLT_EVAL_METHOD__=2 __FLT_HAS_DENORM__=1 __FLT_HAS_INFINITY__=1 __FLT_HAS_QUIET_NAN__=1 __FLT_MANT_DIG__=24 __FLT_MAX_10_EXP__=38 __FLT_MAX_EXP__=128 __FLT_MAX__=3.40282347e+38F __FLT_MIN_10_EXP__=(-37) __FLT_MIN_EXP__=(-125) __FLT_MIN__=1.17549435e-38F __FLT_RADIX__=2 __GCC_HAVE_SYNC_COMPARE_AND_SWAP_1=1 __GCC_HAVE_SYNC_COMPARE_AND_SWAP_2=1 __GCC_HAVE_SYNC_COMPARE_AND_SWAP_4=1 __GCC_HAVE_SYNC_COMPARE_AND_SWAP_8=1 __GLIBC_MINOR__=11 __GLIBC__=2 __GNUC_GNU_INLINE__=1 __GNUC_MINOR__=4 __GNUC_PATCHLEVEL__=4 __GNUC__=4 __GNU_LIBRARY__=6 __GXX_ABI_VERSION=1002 __INTMAX_MAX__=9223372036854775807LL __INTMAX_TYPE__=long\ long\ int __INT_MAX__=2147483647 __LDBL_DENORM_MIN__=3.64519953188247460253e-4951L __LDBL_DIG__=18 __LDBL_EPSILON__=1.08420217248550443401e-19L __LDBL_HAS_DENORM__=1 __LDBL_HAS_INFINITY__=1 __LDBL_HAS_QUIET_NAN__=1 __LDBL_MANT_DIG__=64 __LDBL_MAX_10_EXP__=4932 __LDBL_MAX_EXP__=16384 __LDBL_MAX__=1.18973149535723176502e+4932L __LDBL_MIN_10_EXP__=(-4931) __LDBL_MIN_EXP__=(-16381) __LDBL_MIN__=3.36210314311209350626e-4932L __LONG_LONG_MAX__=9223372036854775807LL __LONG_MAX__=2147483647L __PTRDIFF_TYPE__=int __REGISTER_PREFIX__= __SCHAR_MAX__=127 __SHRT_MAX__=32767 __SIZEOF_DOUBLE__=8 __SIZEOF_FLOAT__=4 __SIZEOF_INT__=4 __SIZEOF_LONG_DOUBLE__=12 __SIZEOF_LONG_LONG__=8 __SIZEOF_LONG__=4 __SIZEOF_POINTER__=4 __SIZEOF_PTRDIFF_T__=4 __SIZEOF_SHORT__=2 __SIZEOF_SIZE_T__=4 __SIZEOF_WCHAR_T__=4 __SIZEOF_WINT_T__=4 __SIZE_TYPE__=unsigned\ int __STDC_HOSTED__=1 __STDC__=1 __UINTMAX_TYPE__=long\ long\ unsigned\ int __USER_LABEL_PREFIX__= __USE_BSD=1 __USE_FILE_OFFSET64=1 __USE_LARGEFILE=1 __USE_MISC=1 __USE_POSIX199309=1 __USE_POSIX199506=1 __USE_POSIX2=1 __USE_POSIX=1 __USE_SVID=1 __VERSION__="4.4.4" __WCHAR_MAX__=2147483647 __WCHAR_TYPE__=long\ int __WINT_TYPE__=unsigned\ int __gnu_linux__=1 __i386=1 __i386__=1 __i686=1 __i686__=1 __linux=1 __linux__=1 __pentiumpro=1 __pentiumpro__=1 __unix=1 __unix__=1 i386=1 linux=1 unix=1' crypt_r_proto='0' cryptlib='' csh='csh' ctermid_r_proto='0' ctime_r_proto='0' d_Gconvert='gcvt((x),(n),(b))' d_PRIEUldbl='define' d_PRIFUldbl='define' d_PRIGUldbl='define' d_PRIXU64='define' d_PRId64='define' d_PRIeldbl='define' d_PRIfldbl='define' d_PRIgldbl='define' d_PRIi64='define' d_PRIo64='define' d_PRIu64='define' d_PRIx64='define' d_SCNfldbl='define' d__fwalk='undef' d_access='define' d_accessx='undef' d_aintl='undef' d_alarm='define' d_archlib='define' d_asctime64='undef' d_asctime_r='undef' d_atolf='undef' d_atoll='define' d_attribute_deprecated='define' d_attribute_format='define' d_attribute_malloc='define' d_attribute_nonnull='define' d_attribute_noreturn='define' d_attribute_pure='define' d_attribute_unused='define' d_attribute_warn_unused_result='define' d_bcmp='define' d_bcopy='define' d_bsd='undef' d_bsdgetpgrp='undef' d_bsdsetpgrp='undef' d_builtin_choose_expr='define' d_builtin_expect='define' d_bzero='define' d_c99_variadic_macros='define' d_casti32='undef' d_castneg='define' d_charvspr='undef' d_chown='define' d_chroot='define' d_chsize='undef' d_class='undef' d_clearenv='define' d_closedir='define' d_cmsghdr_s='define' d_const='define' d_copysignl='define' d_cplusplus='undef' d_crypt='define' d_crypt_r='undef' d_csh='undef' d_ctermid='define' d_ctermid_r='undef' d_ctime64='undef' d_ctime_r='undef' d_cuserid='define' d_dbl_dig='define' d_dbminitproto='undef' d_difftime64='undef' d_difftime='define' d_dir_dd_fd='undef' d_dirfd='define' d_dirnamlen='undef' d_dlerror='define' d_dlopen='define' d_dlsymun='undef' d_dosuid='undef' d_drand48_r='undef' d_drand48proto='define' d_dup2='define' d_eaccess='define' d_endgrent='define' d_endgrent_r='undef' d_endhent='define' d_endhostent_r='undef' d_endnent='define' d_endnetent_r='undef' d_endpent='define' d_endprotoent_r='undef' d_endpwent='define' d_endpwent_r='undef' d_endsent='define' d_endservent_r='undef' d_eofnblk='define' d_eunice='undef' d_faststdio='define' d_fchdir='define' d_fchmod='define' d_fchown='define' d_fcntl='define' d_fcntl_can_lock='define' d_fd_macros='define' d_fd_set='define' d_fds_bits='undef' d_fgetpos='define' d_finite='define' d_finitel='define' d_flexfnam='define' d_flock='define' d_flockproto='define' d_fork='define' d_fp_class='undef' d_fpathconf='define' d_fpclass='undef' d_fpclassify='undef' d_fpclassl='undef' d_fpos64_t='undef' d_frexpl='define' d_fs_data_s='undef' d_fseeko='define' d_fsetpos='define' d_fstatfs='define' d_fstatvfs='define' d_fsync='define' d_ftello='define' d_ftime='undef' d_futimes='define' d_gdbm_ndbm_h_uses_prototypes='undef' d_gdbmndbm_h_uses_prototypes='undef' d_getaddrinfo='define' d_getcwd='define' d_getespwnam='undef' d_getfsstat='undef' d_getgrent='define' d_getgrent_r='undef' d_getgrgid_r='undef' d_getgrnam_r='undef' d_getgrps='define' d_gethbyaddr='define' d_gethbyname='define' d_gethent='define' d_gethname='define' d_gethostbyaddr_r='undef' d_gethostbyname_r='undef' d_gethostent_r='undef' d_gethostprotos='define' d_getitimer='define' d_getlogin='define' d_getlogin_r='undef' d_getmnt='undef' d_getmntent='define' d_getnameinfo='define' d_getnbyaddr='define' d_getnbyname='define' d_getnent='define' d_getnetbyaddr_r='undef' d_getnetbyname_r='undef' d_getnetent_r='undef' d_getnetprotos='define' d_getpagsz='define' d_getpbyname='define' d_getpbynumber='define' d_getpent='define' d_getpgid='define' d_getpgrp2='undef' d_getpgrp='define' d_getppid='define' d_getprior='define' d_getprotobyname_r='undef' d_getprotobynumber_r='undef' d_getprotoent_r='undef' d_getprotoprotos='define' d_getprpwnam='undef' d_getpwent='define' d_getpwent_r='undef' d_getpwnam_r='undef' d_getpwuid_r='undef' d_getsbyname='define' d_getsbyport='define' d_getsent='define' d_getservbyname_r='undef' d_getservbyport_r='undef' d_getservent_r='undef' d_getservprotos='define' d_getspnam='define' d_getspnam_r='undef' d_gettimeod='define' d_gmtime64='undef' d_gmtime_r='undef' d_gnulibc='define' d_grpasswd='define' d_hasmntopt='define' d_htonl='define' d_ilogbl='define' d_inc_version_list='define' d_index='undef' d_inetaton='define' d_inetntop='define' d_inetpton='define' d_int64_t='define' d_isascii='define' d_isfinite='undef' d_isinf='define' d_isnan='define' d_isnanl='define' d_killpg='define' d_lchown='define' d_ldbl_dig='define' d_libm_lib_version='define' d_link='define' d_localtime64='undef' d_localtime_r='undef' d_localtime_r_needs_tzset='undef' d_locconv='define' d_lockf='define' d_longdbl='define' d_longlong='define' d_lseekproto='define' d_lstat='define' d_madvise='define' d_malloc_good_size='undef' d_malloc_size='undef' d_mblen='define' d_mbstowcs='define' d_mbtowc='define' d_memchr='define' d_memcmp='define' d_memcpy='define' d_memmove='define' d_memset='define' d_mkdir='define' d_mkdtemp='define' d_mkfifo='define' d_mkstemp='define' d_mkstemps='define' d_mktime64='undef' d_mktime='define' d_mmap='define' d_modfl='define' d_modfl_pow32_bug='undef' d_modflproto='define' d_mprotect='define' d_msg='define' d_msg_ctrunc='define' d_msg_dontroute='define' d_msg_oob='define' d_msg_peek='define' d_msg_proxy='define' d_msgctl='define' d_msgget='define' d_msghdr_s='define' d_msgrcv='define' d_msgsnd='define' d_msync='define' d_munmap='define' d_mymalloc='undef' d_ndbm='define' d_ndbm_h_uses_prototypes='define' d_nice='define' d_nl_langinfo='define' d_nv_preserves_uv='define' d_nv_zero_is_allbits_zero='define' d_off64_t='undef' d_old_pthread_create_joinable='undef' d_oldpthreads='undef' d_oldsock='undef' d_open3='define' d_pathconf='define' d_pause='define' d_perl_otherlibdirs='undef' d_phostname='undef' d_pipe='define' d_poll='define' d_portable='define' d_printf_format_null='define' d_procselfexe='define' d_pseudofork='undef' d_pthread_atfork='undef' d_pthread_attr_setscope='define' d_pthread_yield='undef' d_pwage='undef' d_pwchange='undef' d_pwclass='undef' d_pwcomment='undef' d_pwexpire='undef' d_pwgecos='define' d_pwpasswd='define' d_pwquota='undef' d_qgcvt='define' d_quad='define' d_random_r='undef' d_readdir64_r='undef' d_readdir='define' d_readdir_r='undef' d_readlink='define' d_readv='define' d_recvmsg='define' d_rename='define' d_rewinddir='define' d_rmdir='define' d_safebcpy='undef' d_safemcpy='undef' d_sanemcmp='define' d_sbrkproto='define' d_scalbnl='define' d_sched_yield='define' d_scm_rights='define' d_seekdir='define' d_select='define' d_sem='define' d_semctl='define' d_semctl_semid_ds='define' d_semctl_semun='define' d_semget='define' d_semop='define' d_sendmsg='define' d_setegid='define' d_seteuid='define' d_setgrent='define' d_setgrent_r='undef' d_setgrps='define' d_sethent='define' d_sethostent_r='undef' d_setitimer='define' d_setlinebuf='define' d_setlocale='define' d_setlocale_r='undef' d_setnent='define' d_setnetent_r='undef' d_setpent='define' d_setpgid='define' d_setpgrp2='undef' d_setpgrp='define' d_setprior='define' d_setproctitle='undef' d_setprotoent_r='undef' d_setpwent='define' d_setpwent_r='undef' d_setregid='define' d_setresgid='define' d_setresuid='define' d_setreuid='define' d_setrgid='undef' d_setruid='undef' d_setsent='define' d_setservent_r='undef' d_setsid='define' d_setvbuf='define' d_sfio='undef' d_shm='define' d_shmat='define' d_shmatprototype='define' d_shmctl='define' d_shmdt='define' d_shmget='define' d_sigaction='define' d_signbit='define' d_sigprocmask='define' d_sigsetjmp='define' d_sitearch='define' d_snprintf='define' d_sockatmark='define' d_sockatmarkproto='define' d_socket='define' d_socklen_t='define' d_sockpair='define' d_socks5_init='undef' d_sprintf_returns_strlen='define' d_sqrtl='define' d_srand48_r='undef' d_srandom_r='undef' d_sresgproto='undef' d_sresuproto='undef' d_statblks='define' d_statfs_f_flags='undef' d_statfs_s='define' d_statvfs='define' d_stdio_cnt_lval='undef' d_stdio_ptr_lval='define' d_stdio_ptr_lval_nochange_cnt='undef' d_stdio_ptr_lval_sets_cnt='define' d_stdio_stream_array='undef' d_stdiobase='define' d_stdstdio='define' d_strchr='define' d_strcoll='define' d_strctcpy='define' d_strerrm='strerror(e)' d_strerror='define' d_strerror_r='undef' d_strftime='define' d_strlcat='undef' d_strlcpy='undef' d_strtod='define' d_strtol='define' d_strtold='define' d_strtoll='define' d_strtoq='define' d_strtoul='define' d_strtoull='define' d_strtouq='define' d_strxfrm='define' d_suidsafe='undef' d_symlink='define' d_syscall='define' d_syscallproto='define' d_sysconf='define' d_sysernlst='' d_syserrlst='define' d_system='define' d_tcgetpgrp='define' d_tcsetpgrp='define' d_telldir='define' d_telldirproto='define' d_time='define' d_timegm='define' d_times='define' d_tm_tm_gmtoff='define' d_tm_tm_zone='define' d_tmpnam_r='undef' d_truncate='define' d_ttyname_r='undef' d_tzname='define' d_u32align='undef' d_ualarm='define' d_umask='define' d_uname='define' d_union_semun='undef' d_unordered='undef' d_unsetenv='define' d_usleep='define' d_usleepproto='define' d_ustat='define' d_vendorarch='define' d_vendorbin='define' d_vendorlib='define' d_vendorscript='define' d_vfork='undef' d_void_closedir='undef' d_voidsig='define' d_voidtty='' d_volatile='define' d_vprintf='define' d_vsnprintf='define' d_wait4='define' d_waitpid='define' d_wcstombs='define' d_wctomb='define' d_writev='define' d_xenix='undef' date='date' db_hashtype='u_int32_t' db_prefixtype='size_t' db_version_major='4' db_version_minor='8' db_version_patch='30' defvoidused='15' direntrytype='struct dirent' dlext='so' dlsrc='dl_dlopen.xs' doublesize='8' drand01='drand48()' drand48_r_proto='0' dtrace='' dynamic_ext='B Compress/Raw/Bzip2 Compress/Raw/Zlib Cwd DB_File Data/Dumper Devel/DProf Devel/PPPort Devel/Peek Digest/MD5 Digest/SHA Encode Fcntl File/Glob Filter/Util/Call GDBM_File Hash/Util Hash/Util/FieldHash I18N/Langinfo IO IPC/SysV List/Util MIME/Base64 Math/BigInt/FastCalc NDBM_File Opcode POSIX PerlIO/encoding PerlIO/scalar PerlIO/via SDBM_File Socket Storable Sys/Hostname Sys/Syslog Text/Soundex Time/HiRes Time/Piece Unicode/Normalize XS/APItest XS/APItest/KeywordRPN XS/Typemap attributes mro re threads threads/shared' eagain='EAGAIN' ebcdic='undef' echo='echo' egrep='egrep' emacs='' endgrent_r_proto='0' endhostent_r_proto='0' endnetent_r_proto='0' endprotoent_r_proto='0' endpwent_r_proto='0' endservent_r_proto='0' eunicefix=':' exe_ext='' expr='expr' extensions='B Compress/Raw/Bzip2 Compress/Raw/Zlib Cwd DB_File Data/Dumper Devel/DProf Devel/PPPort Devel/Peek Digest/MD5 Digest/SHA Encode Fcntl File/Glob Filter/Util/Call GDBM_File Hash/Util Hash/Util/FieldHash I18N/Langinfo IO IPC/SysV List/Util MIME/Base64 Math/BigInt/FastCalc NDBM_File Opcode POSIX PerlIO/encoding PerlIO/scalar PerlIO/via SDBM_File Socket Storable Sys/Hostname Sys/Syslog Text/Soundex Time/HiRes Time/Piece Unicode/Normalize XS/APItest XS/APItest/KeywordRPN XS/Typemap attributes mro re threads threads/shared Archive/Extract Archive/Tar Attribute/Handlers AutoLoader B/Debug B/Deparse B/Lint CGI CPAN CPANPLUS CPANPLUS/Dist/Build Class/ISA Devel/SelfStubber Digest Errno ExtUtils/CBuilder ExtUtils/Command ExtUtils/Constant ExtUtils/Install ExtUtils/MakeMaker ExtUtils/Manifest ExtUtils/ParseXS File/Fetch File/Path File/Temp FileCache Filter/Simple Getopt/Long I18N/LangTags IO/Compress IO/Zlib IPC/Cmd IPC/Open2 IPC/Open3 Locale/Codes Locale/Maketext Locale/Maketext/Simple Log/Message Log/Message/Simple Math/BigInt Math/BigRat Math/Complex Memoize Module/Build Module/CoreList Module/Load Module/Load/Conditional Module/Loaded Module/Pluggable NEXT Net/Ping Object/Accessor Package/Constants Params/Check Parse/CPAN/Meta PerlIO/via/QuotedPrint Pod/Escapes Pod/LaTeX Pod/Parser Pod/Perldoc Pod/Plainer Pod/Simple Safe SelfLoader Shell Switch Term/ANSIColor Term/Cap Term/UI Test Test/Harness Test/Simple Text/Balanced Text/ParseWords Text/Tabs Thread/Queue Thread/Semaphore Tie/File Tie/Memoize Tie/RefHash Time/Local Unicode/Collate XSLoader autodie autouse base bignum constant encoding/warnings if lib libnet parent podlators' extern_C='extern' extras='' fflushNULL='define' fflushall='undef' find='' firstmakefile='makefile' flex='' fpossize='16' fpostype='fpos_t' freetype='void' from=':' full_ar='/usr/bin/ar' full_csh='csh' full_sed='/bin/sed' gccansipedantic='' gccosandvers='' gccversion='4.4.4' getgrent_r_proto='0' getgrgid_r_proto='0' getgrnam_r_proto='0' gethostbyaddr_r_proto='0' gethostbyname_r_proto='0' gethostent_r_proto='0' getlogin_r_proto='0' getnetbyaddr_r_proto='0' getnetbyname_r_proto='0' getnetent_r_proto='0' getprotobyname_r_proto='0' getprotobynumber_r_proto='0' getprotoent_r_proto='0' getpwent_r_proto='0' getpwnam_r_proto='0' getpwuid_r_proto='0' getservbyname_r_proto='0' getservbyport_r_proto='0' getservent_r_proto='0' getspnam_r_proto='0' gidformat='"lu"' gidsign='1' gidsize='4' gidtype='gid_t' glibpth='/usr/shlib /lib /usr/lib /usr/lib/386 /lib/386 /usr/ccs/lib /usr/ucblib /usr/local/lib ' gmake='gmake' gmtime_r_proto='0' gnulibc_version='2.11.2' grep='grep' groupcat='cat /etc/group' groupstype='gid_t' gzip='gzip' h_fcntl='false' h_sysfile='true' hint='recommended' hostcat='cat /etc/hosts' html1dir=' ' html1direxp='' html3dir=' ' html3direxp='' i16size='2' i16type='short' i32size='4' i32type='long' i64size='8' i64type='long long' i8size='1' i8type='signed char' i_arpainet='define' i_assert='define' i_bsdioctl='' i_crypt='define' i_db='define' i_dbm='undef' i_dirent='define' i_dld='undef' i_dlfcn='define' i_fcntl='undef' i_float='define' i_fp='undef' i_fp_class='undef' i_gdbm='define' i_gdbm_ndbm='undef' i_gdbmndbm='define' i_grp='define' i_ieeefp='undef' i_inttypes='define' i_langinfo='define' i_libutil='undef' i_limits='define' i_locale='define' i_machcthr='undef' i_malloc='define' i_mallocmalloc='undef' i_math='define' i_memory='undef' i_mntent='define' i_ndbm='define' i_netdb='define' i_neterrno='undef' i_netinettcp='define' i_niin='define' i_poll='define' i_prot='undef' i_pthread='define' i_pwd='define' i_rpcsvcdbm='undef' i_sfio='undef' i_sgtty='undef' i_shadow='define' i_socks='undef' i_stdarg='define' i_stddef='define' i_stdlib='define' i_string='define' i_sunmath='undef' i_sysaccess='undef' i_sysdir='define' i_sysfile='define' i_sysfilio='undef' i_sysin='undef' i_sysioctl='define' i_syslog='define' i_sysmman='define' i_sysmode='undef' i_sysmount='define' i_sysndir='undef' i_sysparam='define' i_syspoll='define' i_sysresrc='define' i_syssecrt='undef' i_sysselct='define' i_syssockio='undef' i_sysstat='define' i_sysstatfs='define' i_sysstatvfs='define' i_systime='define' i_systimek='undef' i_systimes='define' i_systypes='define' i_sysuio='define' i_sysun='define' i_sysutsname='define' i_sysvfs='define' i_syswait='define' i_termio='undef' i_termios='define' i_time='define' i_unistd='define' i_ustat='define' i_utime='define' i_values='define' i_varargs='undef' i_varhdr='stdarg.h' i_vfork='undef' ignore_versioned_solibs='y' inc_version_list='5.12.1/i686-linux 5.12.1 5.12.0/i686-linux 5.12.0 ' inc_version_list_init='"5.12.1/i686-linux","5.12.1","5.12.0/i686-linux","5.12.0",0' incpath='' inews='' initialinstalllocation='/usr/bin' installarchlib='/usr/lib/perl5/5.12.2/i686-linux' installbin='/usr/bin' installhtml1dir='' installhtml3dir='' installman1dir='/usr/share/man/man1' installman3dir='/usr/share/man/man3' installprefix='/usr' installprefixexp='/usr' installprivlib='/usr/lib/perl5/5.12.2' installscript='/usr/bin' installsitearch='/usr/lib/perl5/site_perl/5.12.2/i686-linux' installsitebin='/usr/bin' installsitehtml1dir='' installsitehtml3dir='' installsitelib='/usr/lib/perl5/site_perl/5.12.2' installsiteman1dir='/usr/share/man/man1' installsiteman3dir='/usr/share/man/man3' installsitescript='/usr/bin' installstyle='lib/perl5' installusrbinperl='undef' installvendorarch='/usr/lib/perl5/vendor_perl/5.12.2/i686-linux' installvendorbin='/usr/bin' installvendorhtml1dir='' installvendorhtml3dir='' installvendorlib='/usr/lib/perl5/vendor_perl/5.12.2' installvendorman1dir='/usr/share/man/man1' installvendorman3dir='/usr/share/man/man3' installvendorscript='/usr/bin' intsize='4' issymlink='test -h' ivdformat='"ld"' ivsize='4' ivtype='long' known_extensions='B Compress/Raw/Bzip2 Compress/Raw/Zlib Cwd DB_File Data/Dumper Devel/DProf Devel/PPPort Devel/Peek Digest/MD5 Digest/SHA Encode Fcntl File/Glob Filter/Util/Call GDBM_File Hash/Util Hash/Util/FieldHash I18N/Langinfo IO IPC/SysV List/Util MIME/Base64 Math/BigInt/FastCalc NDBM_File ODBM_File Opcode POSIX PerlIO/encoding PerlIO/scalar PerlIO/via SDBM_File Socket Storable Sys/Hostname Sys/Syslog Text/Soundex Time/HiRes Time/Piece Unicode/Normalize VMS/DCLsym VMS/Stdio Win32 Win32API/File Win32CORE XS/APItest XS/APItest/KeywordRPN XS/Typemap attributes mro re threads threads/shared ' ksh='' ld='i686-pc-linux-gnu-gcc' lddlflags='-shared -O2 -march=i686 -pipe -L/usr/local/lib -fstack-protector -Wl,-O1 -Wl,--as-needed' ldflags='-Wl,-O1 -Wl,--as-needed -fstack-protector -L/usr/local/lib' ldflags_uselargefiles='' ldlibpthname='LD_LIBRARY_PATH' less='less' lib_ext='.a' libc='/lib/libc-2.11.2.so' libdb_needs_pthread='N' libperl='libperl.so.5.12.2' libpth='/usr/local/lib /lib /usr/lib' libs='-lnsl -lgdbm -ldb -ldl -lm -lcrypt -lutil -lc -lgdbm_compat' libsdirs=' /usr/lib' libsfiles=' libnsl.so libgdbm.so libdb.so libdl.so libm.so libcrypt.so libutil.so libc.so libgdbm_compat.so' libsfound=' /usr/lib/libnsl.so /usr/lib/libgdbm.so /usr/lib/libdb.so /usr/lib/libdl.so /usr/lib/libm.so /usr/lib/libcrypt.so /usr/lib/libutil.so /usr/lib/libc.so /usr/lib/libgdbm_compat.so' libspath=' /usr/local/lib /lib /usr/lib' libswanted='sfio socket inet nsl nm ndbm gdbm dbm db malloc dl dld ld sun m crypt sec util c cposix posix ucb BSD gdbm_compat' libswanted_uselargefiles='' line='' lint='' lkflags='' ln='ln' lns='/bin/ln -s' localtime_r_proto='0' locincpth=' ' loclibpth='/usr/local/lib /opt/local/lib /usr/gnu/lib /opt/gnu/lib /usr/GNU/lib /opt/GNU/lib' longdblsize='12' longlongsize='8' longsize='4' lp='' lpr='' ls='ls' lseeksize='8' lseektype='off_t' mad='undef' madlyh='' madlyobj='' madlysrc='' mail='' mailx='' make='make' make_set_make='#' mallocobj='' mallocsrc='' malloctype='void *' man1dir='/usr/share/man/man1' man1direxp='/usr/share/man/man1' man1ext='1' man3dir='/usr/share/man/man3' man3direxp='/usr/share/man/man3' man3ext='3pm' mips_type='' mistrustnm='' mkdir='mkdir' mmaptype='void *' modetype='mode_t' more='more' multiarch='undef' mv='' myarchname='i686-linux' mydomain='.localdomain' myhostname='localhost' myuname='linux data.wks.liquidweb.com 2.6.35-gentoo-r12 #4 smp thu dec 9 10:47:59 est 2010 i686 pentium(r) dual-core cpu e5400 @ 2.70ghz genuineintel gnulinux ' n='-n' need_va_copy='undef' netdb_hlen_type='size_t' netdb_host_type='const void *' netdb_name_type='const char *' netdb_net_type='in_addr_t' nm='nm' nm_opt='' nm_so_opt='--dynamic' nonxs_ext='Archive/Extract Archive/Tar Attribute/Handlers AutoLoader B/Debug B/Deparse B/Lint CGI CPAN CPANPLUS CPANPLUS/Dist/Build Class/ISA Devel/SelfStubber Digest Errno ExtUtils/CBuilder ExtUtils/Command ExtUtils/Constant ExtUtils/Install ExtUtils/MakeMaker ExtUtils/Manifest ExtUtils/ParseXS File/Fetch File/Path File/Temp FileCache Filter/Simple Getopt/Long I18N/LangTags IO/Compress IO/Zlib IPC/Cmd IPC/Open2 IPC/Open3 Locale/Codes Locale/Maketext Locale/Maketext/Simple Log/Message Log/Message/Simple Math/BigInt Math/BigRat Math/Complex Memoize Module/Build Module/CoreList Module/Load Module/Load/Conditional Module/Loaded Module/Pluggable NEXT Net/Ping Object/Accessor Package/Constants Params/Check Parse/CPAN/Meta PerlIO/via/QuotedPrint Pod/Escapes Pod/LaTeX Pod/Parser Pod/Perldoc Pod/Plainer Pod/Simple Safe SelfLoader Shell Switch Term/ANSIColor Term/Cap Term/UI Test Test/Harness Test/Simple Text/Balanced Text/ParseWords Text/Tabs Thread/Queue Thread/Semaphore Tie/File Tie/Memoize Tie/RefHash Time/Local Unicode/Collate XSLoader autodie autouse base bignum constant encoding/warnings if lib libnet parent podlators' nroff='nroff' nvEUformat='"E"' nvFUformat='"F"' nvGUformat='"G"' nv_overflows_integers_at='256.0*256.0*256.0*256.0*256.0*256.0*2.0*2.0*2.0*2.0*2.0' nv_preserves_uv_bits='32' nveformat='"e"' nvfformat='"f"' nvgformat='"g"' nvsize='8' nvtype='double' o_nonblock='O_NONBLOCK' obj_ext='.o' old_pthread_create_joinable='' optimize='-O2 -march=i686 -pipe' orderlib='false' osname='linux' osvers='2.6.35-gentoo-r12' otherlibdirs=' ' package='perl5' pager='/usr/bin/less -R' passcat='cat /etc/passwd' patchlevel='12' path_sep=':' perl5='/usr/bin/perl' perl='' perl_patchlevel='' perladmin='root@localhost' perllibs='-lnsl -ldl -lm -lcrypt -lutil -lc' perlpath='/usr/bin/perl' pg='pg' phostname='' pidtype='pid_t' plibpth='' pmake='' pr='' prefix='/usr' prefixexp='/usr' privlib='/usr/lib/perl5/5.12.2' privlibexp='/usr/lib/perl5/5.12.2' procselfexe='"/proc/self/exe"' prototype='define' ptrsize='4' quadkind='3' quadtype='long long' randbits='48' randfunc='drand48' random_r_proto='0' randseedtype='long' ranlib=':' rd_nodata='-1' readdir64_r_proto='0' readdir_r_proto='0' revision='5' rm='rm' rm_try='/bin/rm -f try try a.out .out try.[cho] try..o core core.try* try.core*' rmail='' run='' runnm='false' sGMTIME_max='2147483647' sGMTIME_min='-2147483648' sLOCALTIME_max='2147483647' sLOCALTIME_min='-2147483648' sPRIEUldbl='"LE"' sPRIFUldbl='"LF"' sPRIGUldbl='"LG"' sPRIXU64='"LX"' sPRId64='"Ld"' sPRIeldbl='"Le"' sPRIfldbl='"Lf"' sPRIgldbl='"Lg"' sPRIi64='"Li"' sPRIo64='"Lo"' sPRIu64='"Lu"' sPRIx64='"Lx"' sSCNfldbl='"Lf"' sched_yield='sched_yield()' scriptdir='/usr/bin' scriptdirexp='/usr/bin' sed='sed' seedfunc='srand48' selectminbits='32' selecttype='fd_set *' sendmail='' setgrent_r_proto='0' sethostent_r_proto='0' setlocale_r_proto='0' setnetent_r_proto='0' setprotoent_r_proto='0' setpwent_r_proto='0' setservent_r_proto='0' sh='/bin/sh' shar='' sharpbang='#!' shmattype='void *' shortsize='2' shrpenv='' shsharp='true' sig_count='65' sig_name='ZERO HUP INT QUIT ILL TRAP ABRT BUS FPE KILL USR1 SEGV USR2 PIPE ALRM TERM STKFLT CHLD CONT STOP TSTP TTIN TTOU URG XCPU XFSZ VTALRM PROF WINCH IO PWR SYS NUM32 NUM33 RTMIN NUM35 NUM36 NUM37 NUM38 NUM39 NUM40 NUM41 NUM42 NUM43 NUM44 NUM45 NUM46 NUM47 NUM48 NUM49 NUM50 NUM51 NUM52 NUM53 NUM54 NUM55 NUM56 NUM57 NUM58 NUM59 NUM60 NUM61 NUM62 NUM63 RTMAX IOT CLD POLL UNUSED ' sig_name_init='"ZERO", "HUP", "INT", "QUIT", "ILL", "TRAP", "ABRT", "BUS", "FPE", "KILL", "USR1", "SEGV", "USR2", "PIPE", "ALRM", "TERM", "STKFLT", "CHLD", "CONT", "STOP", "TSTP", "TTIN", "TTOU", "URG", "XCPU", "XFSZ", "VTALRM", "PROF", "WINCH", "IO", "PWR", "SYS", "NUM32", "NUM33", "RTMIN", "NUM35", "NUM36", "NUM37", "NUM38", "NUM39", "NUM40", "NUM41", "NUM42", "NUM43", "NUM44", "NUM45", "NUM46", "NUM47", "NUM48", "NUM49", "NUM50", "NUM51", "NUM52", "NUM53", "NUM54", "NUM55", "NUM56", "NUM57", "NUM58", "NUM59", "NUM60", "NUM61", "NUM62", "NUM63", "RTMAX", "IOT", "CLD", "POLL", "UNUSED", 0' sig_num='0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 6 17 29 31 ' sig_num_init='0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 6, 17, 29, 31, 0' sig_size='69' signal_t='void' sitearch='/usr/lib/perl5/site_perl/5.12.2/i686-linux' sitearchexp='/usr/lib/perl5/site_perl/5.12.2/i686-linux' sitebin='/usr/bin' sitebinexp='/usr/bin' sitehtml1dir='' sitehtml1direxp='' sitehtml3dir='' sitehtml3direxp='' sitelib='/usr/lib/perl5/site_perl/5.12.2' sitelib_stem='/usr/lib/perl5/site_perl' sitelibexp='/usr/lib/perl5/site_perl/5.12.2' siteman1dir='/usr/share/man/man1' siteman1direxp='/usr/share/man/man1' siteman3dir='/usr/share/man/man3' siteman3direxp='/usr/share/man/man3' siteprefix='/usr' siteprefixexp='/usr' sitescript='/usr/bin' sitescriptexp='/usr/bin' sizesize='4' sizetype='size_t' sleep='' smail='' so='so' sockethdr='' socketlib='' socksizetype='socklen_t' sort='sort' spackage='Perl5' spitshell='cat' srand48_r_proto='0' srandom_r_proto='0' src='.' ssizetype='ssize_t' startperl='#!/usr/bin/perl' startsh='#!/bin/sh' static_ext=' ' stdchar='char' stdio_base='((fp)->_IO_read_base)' stdio_bufsiz='((fp)->_IO_read_end - (fp)->_IO_read_base)' stdio_cnt='((fp)->_IO_read_end - (fp)->_IO_read_ptr)' stdio_filbuf='' stdio_ptr='((fp)->_IO_read_ptr)' stdio_stream_array='' strerror_r_proto='0' strings='/usr/include/string.h' submit='' subversion='2' sysman='/usr/share/man/man1' tail='' tar='' targetarch='' tbl='' tee='' test='test' timeincl='/usr/include/sys/time.h /usr/include/time.h ' timetype='time_t' tmpnam_r_proto='0' to=':' touch='touch' tr='tr' trnl='\n' troff='' ttyname_r_proto='0' u16size='2' u16type='unsigned short' u32size='4' u32type='unsigned long' u64size='8' u64type='unsigned long long' u8size='1' u8type='unsigned char' uidformat='"lu"' uidsign='1' uidsize='4' uidtype='uid_t' uname='uname' uniq='uniq' uquadtype='unsigned long long' use5005threads='undef' use64bitall='undef' use64bitint='undef' usecrosscompile='undef' usedevel='undef' usedl='define' usedtrace='undef' usefaststdio='undef' useithreads='undef' uselargefiles='define' uselongdouble='undef' usemallocwrap='define' usemorebits='undef' usemultiplicity='undef' usemymalloc='n' usenm='false' useopcode='true' useperlio='define' useposix='true' usereentrant='undef' userelocatableinc='undef' usesfio='false' useshrplib='true' usesitecustomize='undef' usesocks='undef' usethreads='undef' usevendorprefix='define' usevfork='false' usrinc='/usr/include' uuname='' uvXUformat='"lX"' uvoformat='"lo"' uvsize='4' uvtype='unsigned long' uvuformat='"lu"' uvxformat='"lx"' vaproto='define' vendorarch='/usr/lib/perl5/vendor_perl/5.12.2/i686-linux' vendorarchexp='/usr/lib/perl5/vendor_perl/5.12.2/i686-linux' vendorbin='/usr/bin' vendorbinexp='/usr/bin' vendorhtml1dir=' ' vendorhtml1direxp='' vendorhtml3dir=' ' vendorhtml3direxp='' vendorlib='/usr/lib/perl5/vendor_perl/5.12.2' vendorlib_stem='/usr/lib/perl5/vendor_perl' vendorlibexp='/usr/lib/perl5/vendor_perl/5.12.2' vendorman1dir='/usr/share/man/man1' vendorman1direxp='/usr/share/man/man1' vendorman3dir='/usr/share/man/man3' vendorman3direxp='/usr/share/man/man3' vendorprefix='/usr' vendorprefixexp='/usr' vendorscript='/usr/bin' vendorscriptexp='/usr/bin' version='5.12.2' version_patchlevel_string='version 12 subversion 2' versiononly='undef' vi='' voidflags='15' xlibpth='/usr/lib/386 /lib/386' yacc='yacc' yaccflags='' zcat='' zip='zip' !END! my $i = 0; foreach my $c (4,3,2) { $i |= ord($c); $i <<= 8 } $i |= ord(1); our $byteorder = join('', unpack('aaaa', pack('L!', $i))); s/(byteorder=)(['"]).*?\2/$1$2$Config::byteorder$2/m; my $config_sh_len = length $_; our $Config_SH_expanded = "\n$_" . << 'EOVIRTUAL'; ccflags_nolargefiles='-fno-strict-aliasing -pipe -fstack-protector ' ldflags_nolargefiles='-Wl,-O1 -Wl,--as-needed -fstack-protector -L/usr/local/lib' libs_nolargefiles='-lnsl -lgdbm -ldb -ldl -lm -lcrypt -lutil -lc -lgdbm_compat' libswanted_nolargefiles='sfio socket inet nsl nm ndbm gdbm dbm db malloc dl dld ld sun m crypt sec util c cposix posix ucb BSD gdbm_compat' EOVIRTUAL eval { # do not have hairy conniptions if this isnt available require 'Config_git.pl'; $Config_SH_expanded .= $Config::Git_Data; 1; } or warn "Warning: failed to load Config_git.pl, something strange about this perl...\n"; # Search for it in the big string sub fetch_string { my($self, $key) = @_; # We only have ' delimted. my $start = index($Config_SH_expanded, "\n$key=\'"); # Start can never be -1 now, as we've rigged the long string we're # searching with an initial dummy newline. return undef if $start == -1; $start += length($key) + 3; my $value = substr($Config_SH_expanded, $start, index($Config_SH_expanded, "'\n", $start) - $start); # So we can say "if $Config{'foo'}". $value = undef if $value eq 'undef'; $self->{$key} = $value; # cache it } my $prevpos = 0; sub FIRSTKEY { $prevpos = 0; substr($Config_SH_expanded, 1, index($Config_SH_expanded, '=') - 1 ); } sub NEXTKEY { my $pos = index($Config_SH_expanded, qq('\n), $prevpos) + 2; my $len = index($Config_SH_expanded, "=", $pos) - $pos; $prevpos = $pos; $len > 0 ? substr($Config_SH_expanded, $pos, $len) : undef; } sub EXISTS { return 1 if exists($_[0]->{$_[1]}); return(index($Config_SH_expanded, "\n$_[1]='") != -1 ); } sub STORE { die "\%Config::Config is read-only\n" } *DELETE = \&STORE; *CLEAR = \&STORE; sub config_sh { substr $Config_SH_expanded, 1, $config_sh_len; } sub config_re { my $re = shift; return map { chomp; $_ } grep eval{ /^(?:$re)=/ }, split /^/, $Config_SH_expanded; } sub config_vars { # implements -V:cfgvar option (see perlrun -V:) foreach (@_) { # find optional leading, trailing colons; and query-spec my ($notag,$qry,$lncont) = m/^(:)?(.*?)(:)?$/; # flags fore and aft, # map colon-flags to print decorations my $prfx = $notag ? '': "$qry="; # tag-prefix for print my $lnend = $lncont ? ' ' : ";\n"; # line ending for print # all config-vars are by definition \w only, any \W means regex if ($qry =~ /\W/) { my @matches = config_re($qry); print map "$_$lnend", @matches ? @matches : "$qry: not found" if !$notag; print map { s/\w+=//; "$_$lnend" } @matches ? @matches : "$qry: not found" if $notag; } else { my $v = (exists $Config::Config{$qry}) ? $Config::Config{$qry} : 'UNKNOWN'; $v = 'undef' unless defined $v; print "${prfx}'${v}'$lnend"; } } } # Called by the real AUTOLOAD sub launcher { undef &AUTOLOAD; goto \&$Config::AUTOLOAD; } 1; FILE26b3dd3b/DynaLoader.pm+#line 1 "/usr/lib/perl5/5.12.2/i686-linux/DynaLoader.pm" # Generated from DynaLoader_pm.PL package DynaLoader; # And Gandalf said: 'Many folk like to know beforehand what is to # be set on the table; but those who have laboured to prepare the # feast like to keep their secret; for wonder makes the words of # praise louder.' # (Quote from Tolkien suggested by Anno Siegel.) # # See pod text at end of file for documentation. # See also ext/DynaLoader/README in source tree for other information. # # Tim.Bunce@ig.co.uk, August 1994 BEGIN { $VERSION = '1.10'; } require AutoLoader; *AUTOLOAD = \&AutoLoader::AUTOLOAD; use Config; # enable debug/trace messages from DynaLoader perl code $dl_debug = $ENV{PERL_DL_DEBUG} || 0 unless defined $dl_debug; # # Flags to alter dl_load_file behaviour. Assigned bits: # 0x01 make symbols available for linking later dl_load_file's. # (only known to work on Solaris 2 using dlopen(RTLD_GLOBAL)) # (ignored under VMS; effect is built-in to image linking) # # This is called as a class method $module->dl_load_flags. The # definition here will be inherited and result on "default" loading # behaviour unless a sub-class of DynaLoader defines its own version. # sub dl_load_flags { 0x00 } ($dl_dlext, $dl_so, $dlsrc) = @Config::Config{qw(dlext so dlsrc)}; $do_expand = 0; @dl_require_symbols = (); # names of symbols we need @dl_resolve_using = (); # names of files to link with @dl_library_path = (); # path to look for files #XSLoader.pm may have added elements before we were required #@dl_shared_objects = (); # shared objects for symbols we have #@dl_librefs = (); # things we have loaded #@dl_modules = (); # Modules we have loaded # This is a fix to support DLD's unfortunate desire to relink -lc @dl_resolve_using = dl_findfile('-lc') if $dlsrc eq "dl_dld.xs"; # Initialise @dl_library_path with the 'standard' library path # for this platform as determined by Configure. push(@dl_library_path, split(' ', $Config::Config{libpth})); my $ldlibpthname = $Config::Config{ldlibpthname}; my $ldlibpthname_defined = defined $Config::Config{ldlibpthname}; my $pthsep = $Config::Config{path_sep}; # Add to @dl_library_path any extra directories we can gather from environment # during runtime. if ($ldlibpthname_defined && exists $ENV{$ldlibpthname}) { push(@dl_library_path, split(/$pthsep/, $ENV{$ldlibpthname})); } # E.g. HP-UX supports both its native SHLIB_PATH *and* LD_LIBRARY_PATH. if ($ldlibpthname_defined && $ldlibpthname ne 'LD_LIBRARY_PATH' && exists $ENV{LD_LIBRARY_PATH}) { push(@dl_library_path, split(/$pthsep/, $ENV{LD_LIBRARY_PATH})); } # No prizes for guessing why we don't say 'bootstrap DynaLoader;' here. # NOTE: All dl_*.xs (including dl_none.xs) define a dl_error() XSUB boot_DynaLoader('DynaLoader') if defined(&boot_DynaLoader) && !defined(&dl_error); if ($dl_debug) { print STDERR "DynaLoader.pm loaded (@INC, @dl_library_path)\n"; print STDERR "DynaLoader not linked into this perl\n" unless defined(&boot_DynaLoader); } 1; # End of main code sub croak { require Carp; Carp::croak(@_) } sub bootstrap_inherit { my $module = $_[0]; local *isa = *{"$module\::ISA"}; local @isa = (@isa, 'DynaLoader'); # Cannot goto due to delocalization. Will report errors on a wrong line? bootstrap(@_); } # The bootstrap function cannot be autoloaded (without complications) # so we define it here: sub bootstrap { # use local vars to enable $module.bs script to edit values local(@args) = @_; local($module) = $args[0]; local(@dirs, $file); unless ($module) { require Carp; Carp::confess("Usage: DynaLoader::bootstrap(module)"); } # A common error on platforms which don't support dynamic loading. # Since it's fatal and potentially confusing we give a detailed message. croak("Can't load module $module, dynamic loading not available in this perl.\n". " (You may need to build a new perl executable which either supports\n". " dynamic loading or has the $module module statically linked into it.)\n") unless defined(&dl_load_file); my @modparts = split(/::/,$module); my $modfname = $modparts[-1]; # Some systems have restrictions on files names for DLL's etc. # mod2fname returns appropriate file base name (typically truncated) # It may also edit @modparts if required. $modfname = &mod2fname(\@modparts) if defined &mod2fname; my $modpname = join('/',@modparts); print STDERR "DynaLoader::bootstrap for $module ", "(auto/$modpname/$modfname.$dl_dlext)\n" if $dl_debug; foreach (@INC) { my $dir = "$_/auto/$modpname"; next unless -d $dir; # skip over uninteresting directories # check for common cases to avoid autoload of dl_findfile my $try = "$dir/$modfname.$dl_dlext"; last if $file = ($do_expand) ? dl_expandspec($try) : ((-f $try) && $try); # no luck here, save dir for possible later dl_findfile search push @dirs, $dir; } # last resort, let dl_findfile have a go in all known locations $file = dl_findfile(map("-L$_",@dirs,@INC), $modfname) unless $file; croak("Can't locate loadable object for module $module in \@INC (\@INC contains: @INC)") unless $file; # wording similar to error from 'require' my $bootname = "boot_$module"; $bootname =~ s/\W/_/g; @dl_require_symbols = ($bootname); # Execute optional '.bootstrap' perl script for this module. # The .bs file can be used to configure @dl_resolve_using etc to # match the needs of the individual module on this architecture. my $bs = $file; $bs =~ s/(\.\w+)?(;\d*)?$/\.bs/; # look for .bs 'beside' the library if (-s $bs) { # only read file if it's not empty print STDERR "BS: $bs ($^O, $dlsrc)\n" if $dl_debug; eval { do $bs; }; warn "$bs: $@\n" if $@; } my $boot_symbol_ref; # Many dynamic extension loading problems will appear to come from # this section of code: XYZ failed at line 123 of DynaLoader.pm. # Often these errors are actually occurring in the initialisation # C code of the extension XS file. Perl reports the error as being # in this perl code simply because this was the last perl code # it executed. my $libref = dl_load_file($file, $module->dl_load_flags) or croak("Can't load '$file' for module $module: ".dl_error()); push(@dl_librefs,$libref); # record loaded object my @unresolved = dl_undef_symbols(); if (@unresolved) { require Carp; Carp::carp("Undefined symbols present after loading $file: @unresolved\n"); } $boot_symbol_ref = dl_find_symbol($libref, $bootname) or croak("Can't find '$bootname' symbol in $file\n"); push(@dl_modules, $module); # record loaded module boot: my $xs = dl_install_xsub("${module}::bootstrap", $boot_symbol_ref, $file); # See comment block above push(@dl_shared_objects, $file); # record files loaded &$xs(@args); } #sub _check_file { # private utility to handle dl_expandspec vs -f tests # my($file) = @_; # return $file if (!$do_expand && -f $file); # the common case # return $file if ( $do_expand && ($file=dl_expandspec($file))); # return undef; #} # Let autosplit and the autoloader deal with these functions: __END__ sub dl_findfile { # Read ext/DynaLoader/DynaLoader.doc for detailed information. # This function does not automatically consider the architecture # or the perl library auto directories. my (@args) = @_; my (@dirs, $dir); # which directories to search my (@found); # full paths to real files we have found #my $dl_ext= 'so'; # $Config::Config{'dlext'} suffix for perl extensions #my $dl_so = 'so'; # $Config::Config{'so'} suffix for shared libraries print STDERR "dl_findfile(@args)\n" if $dl_debug; # accumulate directories but process files as they appear arg: foreach(@args) { # Special fast case: full filepath requires no search if (m:/: && -f $_) { push(@found,$_); last arg unless wantarray; next; } # Deal with directories first: # Using a -L prefix is the preferred option (faster and more robust) if (m:^-L:) { s/^-L//; push(@dirs, $_); next; } # Otherwise we try to try to spot directories by a heuristic # (this is a more complicated issue than it first appears) if (m:/: && -d $_) { push(@dirs, $_); next; } # Only files should get this far... my(@names, $name); # what filenames to look for if (m:-l: ) { # convert -lname to appropriate library name s/-l//; push(@names,"lib$_.$dl_so"); push(@names,"lib$_.a"); } else { # Umm, a bare name. Try various alternatives: # these should be ordered with the most likely first push(@names,"$_.$dl_dlext") unless m/\.$dl_dlext$/o; push(@names,"$_.$dl_so") unless m/\.$dl_so$/o; push(@names,"lib$_.$dl_so") unless m:/:; push(@names,"$_.a") if !m/\.a$/ and $dlsrc eq "dl_dld.xs"; push(@names, $_); } my $dirsep = '/'; foreach $dir (@dirs, @dl_library_path) { next unless -d $dir; foreach $name (@names) { my($file) = "$dir$dirsep$name"; print STDERR " checking in $dir for $name\n" if $dl_debug; $file = ($do_expand) ? dl_expandspec($file) : (-f $file && $file); #$file = _check_file($file); if ($file) { push(@found, $file); next arg; # no need to look any further } } } } if ($dl_debug) { foreach(@dirs) { print STDERR " dl_findfile ignored non-existent directory: $_\n" unless -d $_; } print STDERR "dl_findfile found: @found\n"; } return $found[0] unless wantarray; @found; } sub dl_expandspec { my($spec) = @_; # Optional function invoked if DynaLoader.pm sets $do_expand. # Most systems do not require or use this function. # Some systems may implement it in the dl_*.xs file in which case # this autoload version will not be called but is harmless. # This function is designed to deal with systems which treat some # 'filenames' in a special way. For example VMS 'Logical Names' # (something like unix environment variables - but different). # This function should recognise such names and expand them into # full file paths. # Must return undef if $spec is invalid or file does not exist. my $file = $spec; # default output to input return undef unless -f $file; print STDERR "dl_expandspec($spec) => $file\n" if $dl_debug; $file; } sub dl_find_symbol_anywhere { my $sym = shift; my $libref; foreach $libref (@dl_librefs) { my $symref = dl_find_symbol($libref,$sym); return $symref if $symref; } return undef; } #line 772 FILEc4031d49/Errno.pmn#line 1 "/usr/lib/perl5/5.12.2/i686-linux/Errno.pm" # # This file is auto-generated. ***ANY*** changes here will be lost # package Errno; our (@EXPORT_OK,%EXPORT_TAGS,@ISA,$VERSION,%errno,$AUTOLOAD); use Exporter (); use Config; use strict; "$Config{'archname'}-$Config{'osvers'}" eq "i686-linux-2.6.35-gentoo-r12" or die "Errno architecture (i686-linux-2.6.35-gentoo-r12) does not match executable architecture ($Config{'archname'}-$Config{'osvers'})"; $VERSION = "1.11"; $VERSION = eval $VERSION; @ISA = qw(Exporter); @EXPORT_OK = qw(EBADR ENOMSG ENOTSUP ESTRPIPE EADDRINUSE EL3HLT EBADF ENOTBLK ENAVAIL ECHRNG ENOTNAM ELNRNG ENOKEY EXDEV EBADE EBADSLT ECONNREFUSED ENOSTR ENONET EOVERFLOW EISCONN EFBIG EKEYREVOKED ECONNRESET EWOULDBLOCK ELIBMAX EREMOTEIO ENOPKG ELIBSCN EDESTADDRREQ ENOTSOCK EIO EMEDIUMTYPE EINPROGRESS ERANGE EAFNOSUPPORT EADDRNOTAVAIL EINTR EREMOTE EILSEQ ENOMEM EPIPE ENETUNREACH ENODATA EUSERS EOPNOTSUPP EPROTO EISNAM ESPIPE EALREADY ENAMETOOLONG ENOEXEC EISDIR EBADRQC EEXIST EDOTDOT ELIBBAD EOWNERDEAD ESRCH EFAULT EXFULL EDEADLOCK EAGAIN ENOPROTOOPT ENETDOWN EPROTOTYPE EL2NSYNC ENETRESET EUCLEAN EADV EROFS ESHUTDOWN EMULTIHOP EPROTONOSUPPORT ENFILE ENOLCK ECONNABORTED ECANCELED EDEADLK ESRMNT ENOLINK ETIME ENOTDIR EINVAL ENOTTY ENOANO ELOOP ENOENT EPFNOSUPPORT EBADMSG ENOMEDIUM EL2HLT EDOM EBFONT EKEYEXPIRED EMSGSIZE ENOCSI EL3RST ENOSPC EIDRM ENOBUFS ENOSYS EHOSTDOWN EBADFD ENOSR ENOTCONN ESTALE EDQUOT EKEYREJECTED EMFILE ENOTRECOVERABLE EACCES EBUSY E2BIG EPERM ELIBEXEC ETOOMANYREFS ELIBACC ENOTUNIQ ECOMM ERESTART ESOCKTNOSUPPORT EUNATCH ETIMEDOUT ENXIO ENODEV ETXTBSY EMLINK ECHILD EHOSTUNREACH EREMCHG ENOTEMPTY); %EXPORT_TAGS = ( POSIX => [qw( E2BIG EACCES EADDRINUSE EADDRNOTAVAIL EAFNOSUPPORT EAGAIN EALREADY EBADF EBUSY ECHILD ECONNABORTED ECONNREFUSED ECONNRESET EDEADLK EDESTADDRREQ EDOM EDQUOT EEXIST EFAULT EFBIG EHOSTDOWN EHOSTUNREACH EINPROGRESS EINTR EINVAL EIO EISCONN EISDIR ELOOP EMFILE EMLINK EMSGSIZE ENAMETOOLONG ENETDOWN ENETRESET ENETUNREACH ENFILE ENOBUFS ENODEV ENOENT ENOEXEC ENOLCK ENOMEM ENOPROTOOPT ENOSPC ENOSYS ENOTBLK ENOTCONN ENOTDIR ENOTEMPTY ENOTSOCK ENOTTY ENXIO EOPNOTSUPP EPERM EPFNOSUPPORT EPIPE EPROTONOSUPPORT EPROTOTYPE ERANGE EREMOTE ERESTART EROFS ESHUTDOWN ESOCKTNOSUPPORT ESPIPE ESRCH ESTALE ETIMEDOUT ETOOMANYREFS ETXTBSY EUSERS EWOULDBLOCK EXDEV )] ); sub EPERM () { 1 } sub ENOENT () { 2 } sub ESRCH () { 3 } sub EINTR () { 4 } sub EIO () { 5 } sub ENXIO () { 6 } sub E2BIG () { 7 } sub ENOEXEC () { 8 } sub EBADF () { 9 } sub ECHILD () { 10 } sub EWOULDBLOCK () { 11 } sub EAGAIN () { 11 } sub ENOMEM () { 12 } sub EACCES () { 13 } sub EFAULT () { 14 } sub ENOTBLK () { 15 } sub EBUSY () { 16 } sub EEXIST () { 17 } sub EXDEV () { 18 } sub ENODEV () { 19 } sub ENOTDIR () { 20 } sub EISDIR () { 21 } sub EINVAL () { 22 } sub ENFILE () { 23 } sub EMFILE () { 24 } sub ENOTTY () { 25 } sub ETXTBSY () { 26 } sub EFBIG () { 27 } sub ENOSPC () { 28 } sub ESPIPE () { 29 } sub EROFS () { 30 } sub EMLINK () { 31 } sub EPIPE () { 32 } sub EDOM () { 33 } sub ERANGE () { 34 } sub EDEADLOCK () { 35 } sub EDEADLK () { 35 } sub ENAMETOOLONG () { 36 } sub ENOLCK () { 37 } sub ENOSYS () { 38 } sub ENOTEMPTY () { 39 } sub ELOOP () { 40 } sub ENOMSG () { 42 } sub EIDRM () { 43 } sub ECHRNG () { 44 } sub EL2NSYNC () { 45 } sub EL3HLT () { 46 } sub EL3RST () { 47 } sub ELNRNG () { 48 } sub EUNATCH () { 49 } sub ENOCSI () { 50 } sub EL2HLT () { 51 } sub EBADE () { 52 } sub EBADR () { 53 } sub EXFULL () { 54 } sub ENOANO () { 55 } sub EBADRQC () { 56 } sub EBADSLT () { 57 } sub EBFONT () { 59 } sub ENOSTR () { 60 } sub ENODATA () { 61 } sub ETIME () { 62 } sub ENOSR () { 63 } sub ENONET () { 64 } sub ENOPKG () { 65 } sub EREMOTE () { 66 } sub ENOLINK () { 67 } sub EADV () { 68 } sub ESRMNT () { 69 } sub ECOMM () { 70 } sub EPROTO () { 71 } sub EMULTIHOP () { 72 } sub EDOTDOT () { 73 } sub EBADMSG () { 74 } sub EOVERFLOW () { 75 } sub ENOTUNIQ () { 76 } sub EBADFD () { 77 } sub EREMCHG () { 78 } sub ELIBACC () { 79 } sub ELIBBAD () { 80 } sub ELIBSCN () { 81 } sub ELIBMAX () { 82 } sub ELIBEXEC () { 83 } sub EILSEQ () { 84 } sub ERESTART () { 85 } sub ESTRPIPE () { 86 } sub EUSERS () { 87 } sub ENOTSOCK () { 88 } sub EDESTADDRREQ () { 89 } sub EMSGSIZE () { 90 } sub EPROTOTYPE () { 91 } sub ENOPROTOOPT () { 92 } sub EPROTONOSUPPORT () { 93 } sub ESOCKTNOSUPPORT () { 94 } sub ENOTSUP () { 95 } sub EOPNOTSUPP () { 95 } sub EPFNOSUPPORT () { 96 } sub EAFNOSUPPORT () { 97 } sub EADDRINUSE () { 98 } sub EADDRNOTAVAIL () { 99 } sub ENETDOWN () { 100 } sub ENETUNREACH () { 101 } sub ENETRESET () { 102 } sub ECONNABORTED () { 103 } sub ECONNRESET () { 104 } sub ENOBUFS () { 105 } sub EISCONN () { 106 } sub ENOTCONN () { 107 } sub ESHUTDOWN () { 108 } sub ETOOMANYREFS () { 109 } sub ETIMEDOUT () { 110 } sub ECONNREFUSED () { 111 } sub EHOSTDOWN () { 112 } sub EHOSTUNREACH () { 113 } sub EALREADY () { 114 } sub EINPROGRESS () { 115 } sub ESTALE () { 116 } sub EUCLEAN () { 117 } sub ENOTNAM () { 118 } sub ENAVAIL () { 119 } sub EISNAM () { 120 } sub EREMOTEIO () { 121 } sub EDQUOT () { 122 } sub ENOMEDIUM () { 123 } sub EMEDIUMTYPE () { 124 } sub ECANCELED () { 125 } sub ENOKEY () { 126 } sub EKEYEXPIRED () { 127 } sub EKEYREVOKED () { 128 } sub EKEYREJECTED () { 129 } sub EOWNERDEAD () { 130 } sub ENOTRECOVERABLE () { 131 } sub TIEHASH { bless [] } sub FETCH { my ($self, $errname) = @_; my $proto = prototype("Errno::$errname"); my $errno = ""; if (defined($proto) && $proto eq "") { no strict 'refs'; $errno = &$errname; $errno = 0 unless $! == $errno; } return $errno; } sub STORE { require Carp; Carp::confess("ERRNO hash is read only!"); } *CLEAR = \&STORE; *DELETE = \&STORE; sub NEXTKEY { my($k,$v); while(($k,$v) = each %Errno::) { my $proto = prototype("Errno::$k"); last if (defined($proto) && $proto eq ""); } $k } sub FIRSTKEY { my $s = scalar keys %Errno::; # initialize iterator goto &NEXTKEY; } sub EXISTS { my ($self, $errname) = @_; my $r = ref $errname; my $proto = !$r || $r eq 'CODE' ? prototype($errname) : undef; defined($proto) && $proto eq ""; } tie %!, __PACKAGE__; 1; __END__ #line 285 FILEe37c232d/Fcntl.pm##line 1 "/usr/lib/perl5/5.12.2/i686-linux/Fcntl.pm" package Fcntl; #line 57 use strict; our($VERSION, @ISA, @EXPORT, @EXPORT_OK, %EXPORT_TAGS, $AUTOLOAD); require Exporter; use XSLoader (); @ISA = qw(Exporter); BEGIN { $VERSION = "1.06"; } # Items to export into callers namespace by default # (move infrequently used names to @EXPORT_OK below) @EXPORT = qw( FD_CLOEXEC F_ALLOCSP F_ALLOCSP64 F_COMPAT F_DUP2FD F_DUPFD F_EXLCK F_FREESP F_FREESP64 F_FSYNC F_FSYNC64 F_GETFD F_GETFL F_GETLK F_GETLK64 F_GETOWN F_NODNY F_POSIX F_RDACC F_RDDNY F_RDLCK F_RWACC F_RWDNY F_SETFD F_SETFL F_SETLK F_SETLK64 F_SETLKW F_SETLKW64 F_SETOWN F_SHARE F_SHLCK F_UNLCK F_UNSHARE F_WRACC F_WRDNY F_WRLCK O_ACCMODE O_ALIAS O_APPEND O_ASYNC O_BINARY O_CREAT O_DEFER O_DIRECT O_DIRECTORY O_DSYNC O_EXCL O_EXLOCK O_LARGEFILE O_NDELAY O_NOCTTY O_NOFOLLOW O_NOINHERIT O_NONBLOCK O_RANDOM O_RAW O_RDONLY O_RDWR O_RSRC O_RSYNC O_SEQUENTIAL O_SHLOCK O_SYNC O_TEMPORARY O_TEXT O_TRUNC O_WRONLY ); # Other items we are prepared to export if requested @EXPORT_OK = qw( DN_ACCESS DN_ATTRIB DN_CREATE DN_DELETE DN_MODIFY DN_MULTISHOT DN_RENAME FAPPEND FASYNC FCREAT FDEFER FDSYNC FEXCL FLARGEFILE FNDELAY FNONBLOCK FRSYNC FSYNC FTRUNC F_GETLEASE F_GETSIG F_NOTIFY F_SETLEASE F_SETSIG LOCK_EX LOCK_MAND LOCK_NB LOCK_READ LOCK_RW LOCK_SH LOCK_UN LOCK_WRITE O_IGNORE_CTTY O_NOATIME O_NOLINK O_NOTRANS SEEK_CUR SEEK_END SEEK_SET S_IFSOCK S_IFBLK S_IFCHR S_IFIFO S_IFWHT S_ENFMT S_IREAD S_IWRITE S_IEXEC S_IRGRP S_IWGRP S_IXGRP S_IRWXG S_IROTH S_IWOTH S_IXOTH S_IRWXO S_IRUSR S_IWUSR S_IXUSR S_IRWXU S_ISUID S_ISGID S_ISVTX S_ISTXT _S_IFMT S_IFREG S_IFDIR S_IFLNK &S_ISREG &S_ISDIR &S_ISLNK &S_ISSOCK &S_ISBLK &S_ISCHR &S_ISFIFO &S_ISWHT &S_ISENFMT &S_IFMT &S_IMODE ); # Named groups of exports %EXPORT_TAGS = ( 'flock' => [qw(LOCK_SH LOCK_EX LOCK_NB LOCK_UN)], 'Fcompat' => [qw(FAPPEND FASYNC FCREAT FDEFER FDSYNC FEXCL FLARGEFILE FNDELAY FNONBLOCK FRSYNC FSYNC FTRUNC)], 'seek' => [qw(SEEK_SET SEEK_CUR SEEK_END)], 'mode' => [qw(S_ISUID S_ISGID S_ISVTX S_ISTXT _S_IFMT S_IFREG S_IFDIR S_IFLNK S_IFSOCK S_IFBLK S_IFCHR S_IFIFO S_IFWHT S_ENFMT S_IRUSR S_IWUSR S_IXUSR S_IRWXU S_IRGRP S_IWGRP S_IXGRP S_IRWXG S_IROTH S_IWOTH S_IXOTH S_IRWXO S_IREAD S_IWRITE S_IEXEC S_ISREG S_ISDIR S_ISLNK S_ISSOCK S_ISBLK S_ISCHR S_ISFIFO S_ISWHT S_ISENFMT S_IFMT S_IMODE )], ); # Force the constants to become inlined BEGIN { XSLoader::load 'Fcntl', $VERSION; } sub S_IFMT { @_ ? ( $_[0] & _S_IFMT() ) : _S_IFMT() } sub S_IMODE { $_[0] & 07777 } sub S_ISREG { ( $_[0] & _S_IFMT() ) == S_IFREG() } sub S_ISDIR { ( $_[0] & _S_IFMT() ) == S_IFDIR() } sub S_ISLNK { ( $_[0] & _S_IFMT() ) == S_IFLNK() } sub S_ISSOCK { ( $_[0] & _S_IFMT() ) == S_IFSOCK() } sub S_ISBLK { ( $_[0] & _S_IFMT() ) == S_IFBLK() } sub S_ISCHR { ( $_[0] & _S_IFMT() ) == S_IFCHR() } sub S_ISFIFO { ( $_[0] & _S_IFMT() ) == S_IFIFO() } sub S_ISWHT { ( $_[0] & _S_IFMT() ) == S_IFWHT() } sub S_ISENFMT { ( $_[0] & _S_IFMT() ) == S_IFENFMT() } sub AUTOLOAD { (my $constname = $AUTOLOAD) =~ s/.*:://; die "&Fcntl::constant not defined" if $constname eq 'constant'; my ($error, $val) = constant($constname); if ($error) { my (undef,$file,$line) = caller; die "$error at $file line $line.\n"; } no strict 'refs'; *$AUTOLOAD = sub { $val }; goto &$AUTOLOAD; } 1; FILEb189ca23/File/Glob.pm2#line 1 "/usr/lib/perl5/5.12.2/i686-linux/File/Glob.pm" package File::Glob; use strict; our($VERSION, @ISA, @EXPORT_OK, @EXPORT_FAIL, %EXPORT_TAGS, $AUTOLOAD, $DEFAULT_FLAGS); use XSLoader (); @ISA = qw(Exporter); # NOTE: The glob() export is only here for compatibility with 5.6.0. # csh_glob() should not be used directly, unless you know what you're doing. @EXPORT_OK = qw( csh_glob bsd_glob glob GLOB_ABEND GLOB_ALPHASORT GLOB_ALTDIRFUNC GLOB_BRACE GLOB_CSH GLOB_ERR GLOB_ERROR GLOB_LIMIT GLOB_MARK GLOB_NOCASE GLOB_NOCHECK GLOB_NOMAGIC GLOB_NOSORT GLOB_NOSPACE GLOB_QUOTE GLOB_TILDE ); %EXPORT_TAGS = ( 'glob' => [ qw( GLOB_ABEND GLOB_ALPHASORT GLOB_ALTDIRFUNC GLOB_BRACE GLOB_CSH GLOB_ERR GLOB_ERROR GLOB_LIMIT GLOB_MARK GLOB_NOCASE GLOB_NOCHECK GLOB_NOMAGIC GLOB_NOSORT GLOB_NOSPACE GLOB_QUOTE GLOB_TILDE glob bsd_glob ) ], ); $VERSION = '1.07'; sub import { require Exporter; my $i = 1; while ($i < @_) { if ($_[$i] =~ /^:(case|nocase|globally)$/) { splice(@_, $i, 1); $DEFAULT_FLAGS &= ~GLOB_NOCASE() if $1 eq 'case'; $DEFAULT_FLAGS |= GLOB_NOCASE() if $1 eq 'nocase'; if ($1 eq 'globally') { local $^W; *CORE::GLOBAL::glob = \&File::Glob::csh_glob; } next; } ++$i; } goto &Exporter::import; } sub AUTOLOAD { # This AUTOLOAD is used to 'autoload' constants from the constant() # XS function. If a constant is not found then control is passed # to the AUTOLOAD in AutoLoader. my $constname; ($constname = $AUTOLOAD) =~ s/.*:://; my ($error, $val) = constant($constname); if ($error) { require Carp; Carp::croak($error); } eval "sub $AUTOLOAD { $val }"; goto &$AUTOLOAD; } XSLoader::load 'File::Glob', $VERSION; # Preloaded methods go here. sub GLOB_ERROR { return (constant('GLOB_ERROR'))[1]; } sub GLOB_CSH () { GLOB_BRACE() | GLOB_NOMAGIC() | GLOB_QUOTE() | GLOB_TILDE() | GLOB_ALPHASORT() } $DEFAULT_FLAGS = GLOB_CSH(); if ($^O =~ /^(?:MSWin32|VMS|os2|dos|riscos|MacOS)$/) { $DEFAULT_FLAGS |= GLOB_NOCASE(); } # Autoload methods go after =cut, and are processed by the autosplit program. sub bsd_glob { my ($pat,$flags) = @_; $flags = $DEFAULT_FLAGS if @_ < 2; return doglob($pat,$flags); } # File::Glob::glob() is deprecated because its prototype is different from # CORE::glob() (use bsd_glob() instead) sub glob { splice @_, 1; # don't pass PL_glob_index as flags! goto &bsd_glob; } ## borrowed heavily from gsar's File::DosGlob my %iter; my %entries; sub csh_glob { my $pat = shift; my $cxix = shift; my @pat; # glob without args defaults to $_ $pat = $_ unless defined $pat; # extract patterns $pat =~ s/^\s+//; # Protect against empty elements in $pat =~ s/\s+$//; # things like < *.c> and <*.c >. # These alone shouldn't trigger ParseWords. if ($pat =~ /\s/) { # XXX this is needed for compatibility with the csh # implementation in Perl. Need to support a flag # to disable this behavior. require Text::ParseWords; @pat = Text::ParseWords::parse_line('\s+',0,$pat); } # assume global context if not provided one $cxix = '_G_' unless defined $cxix; $iter{$cxix} = 0 unless exists $iter{$cxix}; # if we're just beginning, do it all first if ($iter{$cxix} == 0) { if (@pat) { $entries{$cxix} = [ map { doglob($_, $DEFAULT_FLAGS) } @pat ]; } else { $entries{$cxix} = [ doglob($pat, $DEFAULT_FLAGS) ]; } } # chuck it all out, quick or slow if (wantarray) { delete $iter{$cxix}; return @{delete $entries{$cxix}}; } else { if ($iter{$cxix} = scalar @{$entries{$cxix}}) { return shift @{$entries{$cxix}}; } else { # return undef for EOL delete $iter{$cxix}; delete $entries{$cxix}; return undef; } } } 1; __END__ #line 497 FILE65a34810/IO.pm#line 1 "/usr/lib/perl5/5.12.2/i686-linux/IO.pm" # package IO; use XSLoader (); use Carp; use strict; use warnings; our $VERSION = "1.25_02"; XSLoader::load 'IO', $VERSION; sub import { shift; warnings::warnif('deprecated', qq{Parameterless "use IO" deprecated}) if @_ == 0 ; my @l = @_ ? @_ : qw(Handle Seekable File Pipe Socket Dir); eval join("", map { "require IO::" . (/(\w+)/)[0] . ";\n" } @l) or croak $@; } 1; __END__ #line 68 FILEed867e6e/IO/File.pm#line 1 "/usr/lib/perl5/5.12.2/i686-linux/IO/File.pm" # package IO::File; #line 126 use 5.006_001; use strict; our($VERSION, @EXPORT, @EXPORT_OK, @ISA); use Carp; use Symbol; use SelectSaver; use IO::Seekable; use File::Spec; require Exporter; @ISA = qw(IO::Handle IO::Seekable Exporter); $VERSION = "1.14"; @EXPORT = @IO::Seekable::EXPORT; eval { # Make all Fcntl O_XXX constants available for importing require Fcntl; my @O = grep /^O_/, @Fcntl::EXPORT; Fcntl->import(@O); # first we import what we want to export push(@EXPORT, @O); }; ################################################ ## Constructor ## sub new { my $type = shift; my $class = ref($type) || $type || "IO::File"; @_ >= 0 && @_ <= 3 or croak "usage: new $class [FILENAME [,MODE [,PERMS]]]"; my $fh = $class->SUPER::new(); if (@_) { $fh->open(@_) or return undef; } $fh; } ################################################ ## Open ## sub open { @_ >= 2 && @_ <= 4 or croak 'usage: $fh->open(FILENAME [,MODE [,PERMS]])'; my ($fh, $file) = @_; if (@_ > 2) { my ($mode, $perms) = @_[2, 3]; if ($mode =~ /^\d+$/) { defined $perms or $perms = 0666; return sysopen($fh, $file, $mode, $perms); } elsif ($mode =~ /:/) { return open($fh, $mode, $file) if @_ == 3; croak 'usage: $fh->open(FILENAME, IOLAYERS)'; } else { return open($fh, IO::Handle::_open_mode_string($mode), $file); } } open($fh, $file); } ################################################ ## Binmode ## sub binmode { ( @_ == 1 or @_ == 2 ) or croak 'usage $fh->binmode([LAYER])'; my($fh, $layer) = @_; return binmode $$fh unless $layer; return binmode $$fh, $layer; } 1; FILEcc002d07/IO/Handle.pmT#line 1 "/usr/lib/perl5/5.12.2/i686-linux/IO/Handle.pm" package IO::Handle; #line 259 use 5.006_001; use strict; our($VERSION, @EXPORT_OK, @ISA); use Carp; use Symbol; use SelectSaver; use IO (); # Load the XS module require Exporter; @ISA = qw(Exporter); $VERSION = "1.28"; $VERSION = eval $VERSION; @EXPORT_OK = qw( autoflush output_field_separator output_record_separator input_record_separator input_line_number format_page_number format_lines_per_page format_lines_left format_name format_top_name format_line_break_characters format_formfeed format_write print printf say getline getlines printflush flush SEEK_SET SEEK_CUR SEEK_END _IOFBF _IOLBF _IONBF ); ################################################ ## Constructors, destructors. ## sub new { my $class = ref($_[0]) || $_[0] || "IO::Handle"; @_ == 1 or croak "usage: new $class"; my $io = gensym; bless $io, $class; } sub new_from_fd { my $class = ref($_[0]) || $_[0] || "IO::Handle"; @_ == 3 or croak "usage: new_from_fd $class FD, MODE"; my $io = gensym; shift; IO::Handle::fdopen($io, @_) or return undef; bless $io, $class; } # # There is no need for DESTROY to do anything, because when the # last reference to an IO object is gone, Perl automatically # closes its associated files (if any). However, to avoid any # attempts to autoload DESTROY, we here define it to do nothing. # sub DESTROY {} ################################################ ## Open and close. ## sub _open_mode_string { my ($mode) = @_; $mode =~ /^\+?(<|>>?)$/ or $mode =~ s/^r(\+?)$/$1/ or $mode =~ s/^a(\+?)$/$1>>/ or croak "IO::Handle: bad open mode: $mode"; $mode; } sub fdopen { @_ == 3 or croak 'usage: $io->fdopen(FD, MODE)'; my ($io, $fd, $mode) = @_; local(*GLOB); if (ref($fd) && "".$fd =~ /GLOB\(/o) { # It's a glob reference; Alias it as we cannot get name of anon GLOBs my $n = qualify(*GLOB); *GLOB = *{*$fd}; $fd = $n; } elsif ($fd =~ m#^\d+$#) { # It's an FD number; prefix with "=". $fd = "=$fd"; } open($io, _open_mode_string($mode) . '&' . $fd) ? $io : undef; } sub close { @_ == 1 or croak 'usage: $io->close()'; my($io) = @_; close($io); } ################################################ ## Normal I/O functions. ## # flock # select sub opened { @_ == 1 or croak 'usage: $io->opened()'; defined fileno($_[0]); } sub fileno { @_ == 1 or croak 'usage: $io->fileno()'; fileno($_[0]); } sub getc { @_ == 1 or croak 'usage: $io->getc()'; getc($_[0]); } sub eof { @_ == 1 or croak 'usage: $io->eof()'; eof($_[0]); } sub print { @_ or croak 'usage: $io->print(ARGS)'; my $this = shift; print $this @_; } sub printf { @_ >= 2 or croak 'usage: $io->printf(FMT,[ARGS])'; my $this = shift; printf $this @_; } sub say { @_ or croak 'usage: $io->say(ARGS)'; my $this = shift; local $\ = "\n"; print $this @_; } sub getline { @_ == 1 or croak 'usage: $io->getline()'; my $this = shift; return scalar <$this>; } *gets = \&getline; # deprecated sub getlines { @_ == 1 or croak 'usage: $io->getlines()'; wantarray or croak 'Can\'t call $io->getlines in a scalar context, use $io->getline'; my $this = shift; return <$this>; } sub truncate { @_ == 2 or croak 'usage: $io->truncate(LEN)'; truncate($_[0], $_[1]); } sub read { @_ == 3 || @_ == 4 or croak 'usage: $io->read(BUF, LEN [, OFFSET])'; read($_[0], $_[1], $_[2], $_[3] || 0); } sub sysread { @_ == 3 || @_ == 4 or croak 'usage: $io->sysread(BUF, LEN [, OFFSET])'; sysread($_[0], $_[1], $_[2], $_[3] || 0); } sub write { @_ >= 2 && @_ <= 4 or croak 'usage: $io->write(BUF [, LEN [, OFFSET]])'; local($\) = ""; $_[2] = length($_[1]) unless defined $_[2]; print { $_[0] } substr($_[1], $_[3] || 0, $_[2]); } sub syswrite { @_ >= 2 && @_ <= 4 or croak 'usage: $io->syswrite(BUF [, LEN [, OFFSET]])'; if (defined($_[2])) { syswrite($_[0], $_[1], $_[2], $_[3] || 0); } else { syswrite($_[0], $_[1]); } } sub stat { @_ == 1 or croak 'usage: $io->stat()'; stat($_[0]); } ################################################ ## State modification functions. ## sub autoflush { my $old = new SelectSaver qualify($_[0], caller); my $prev = $|; $| = @_ > 1 ? $_[1] : 1; $prev; } sub output_field_separator { carp "output_field_separator is not supported on a per-handle basis" if ref($_[0]); my $prev = $,; $, = $_[1] if @_ > 1; $prev; } sub output_record_separator { carp "output_record_separator is not supported on a per-handle basis" if ref($_[0]); my $prev = $\; $\ = $_[1] if @_ > 1; $prev; } sub input_record_separator { carp "input_record_separator is not supported on a per-handle basis" if ref($_[0]); my $prev = $/; $/ = $_[1] if @_ > 1; $prev; } sub input_line_number { local $.; () = tell qualify($_[0], caller) if ref($_[0]); my $prev = $.; $. = $_[1] if @_ > 1; $prev; } sub format_page_number { my $old; $old = new SelectSaver qualify($_[0], caller) if ref($_[0]); my $prev = $%; $% = $_[1] if @_ > 1; $prev; } sub format_lines_per_page { my $old; $old = new SelectSaver qualify($_[0], caller) if ref($_[0]); my $prev = $=; $= = $_[1] if @_ > 1; $prev; } sub format_lines_left { my $old; $old = new SelectSaver qualify($_[0], caller) if ref($_[0]); my $prev = $-; $- = $_[1] if @_ > 1; $prev; } sub format_name { my $old; $old = new SelectSaver qualify($_[0], caller) if ref($_[0]); my $prev = $~; $~ = qualify($_[1], caller) if @_ > 1; $prev; } sub format_top_name { my $old; $old = new SelectSaver qualify($_[0], caller) if ref($_[0]); my $prev = $^; $^ = qualify($_[1], caller) if @_ > 1; $prev; } sub format_line_break_characters { carp "format_line_break_characters is not supported on a per-handle basis" if ref($_[0]); my $prev = $:; $: = $_[1] if @_ > 1; $prev; } sub format_formfeed { carp "format_formfeed is not supported on a per-handle basis" if ref($_[0]); my $prev = $^L; $^L = $_[1] if @_ > 1; $prev; } sub formline { my $io = shift; my $picture = shift; local($^A) = $^A; local($\) = ""; formline($picture, @_); print $io $^A; } sub format_write { @_ < 3 || croak 'usage: $io->write( [FORMAT_NAME] )'; if (@_ == 2) { my ($io, $fmt) = @_; my $oldfmt = $io->format_name(qualify($fmt,caller)); CORE::write($io); $io->format_name($oldfmt); } else { CORE::write($_[0]); } } sub fcntl { @_ == 3 || croak 'usage: $io->fcntl( OP, VALUE );'; my ($io, $op) = @_; return fcntl($io, $op, $_[2]); } sub ioctl { @_ == 3 || croak 'usage: $io->ioctl( OP, VALUE );'; my ($io, $op) = @_; return ioctl($io, $op, $_[2]); } # this sub is for compatability with older releases of IO that used # a sub called constant to detemine if a constant existed -- GMB # # The SEEK_* and _IO?BF constants were the only constants at that time # any new code should just chech defined(&CONSTANT_NAME) sub constant { no strict 'refs'; my $name = shift; (($name =~ /^(SEEK_(SET|CUR|END)|_IO[FLN]BF)$/) && defined &{$name}) ? &{$name}() : undef; } # so that flush.pl can be deprecated sub printflush { my $io = shift; my $old; $old = new SelectSaver qualify($io, caller) if ref($io); local $| = 1; if(ref($io)) { print $io @_; } else { print @_; } } 1; FILEae4b3010/IO/Seekable.pm#line 1 "/usr/lib/perl5/5.12.2/i686-linux/IO/Seekable.pm" # package IO::Seekable; #line 96 use 5.006_001; use Carp; use strict; our($VERSION, @EXPORT, @ISA); use IO::Handle (); # XXX we can't get these from IO::Handle or we'll get prototype # mismatch warnings on C :-( use Fcntl qw(SEEK_SET SEEK_CUR SEEK_END); require Exporter; @EXPORT = qw(SEEK_SET SEEK_CUR SEEK_END); @ISA = qw(Exporter); $VERSION = "1.10"; $VERSION = eval $VERSION; sub seek { @_ == 3 or croak 'usage: $io->seek(POS, WHENCE)'; seek($_[0], $_[1], $_[2]); } sub sysseek { @_ == 3 or croak 'usage: $io->sysseek(POS, WHENCE)'; sysseek($_[0], $_[1], $_[2]); } sub tell { @_ == 1 or croak 'usage: $io->tell()'; tell($_[0]); } 1; FILE8ecef184/PerlIO/scalar.pm#line 1 "/usr/lib/perl5/5.12.2/i686-linux/PerlIO/scalar.pm" package PerlIO::scalar; our $VERSION = '0.08'; use XSLoader (); XSLoader::load 'PerlIO::scalar'; 1; __END__ #line 42 FILE73fb17de/attributes.pm #line 1 "/usr/lib/perl5/5.12.2/i686-linux/attributes.pm" package attributes; our $VERSION = 0.12; @EXPORT_OK = qw(get reftype); @EXPORT = (); %EXPORT_TAGS = (ALL => [@EXPORT, @EXPORT_OK]); use strict; sub croak { require Carp; goto &Carp::croak; } sub carp { require Carp; goto &Carp::carp; } my %deprecated; $deprecated{CODE} = qr/\A-?(locked)\z/; $deprecated{ARRAY} = $deprecated{HASH} = $deprecated{SCALAR} = qr/\A-?(unique)\z/; sub _modify_attrs_and_deprecate { my $svtype = shift; # Now that we've removed handling of locked from the XS code, we need to # remove it here, else it ends up in @badattrs. (If we do the deprecation in # XS, we can't control the warning based on *our* caller's lexical settings, # and the warned line is in this package) grep { $deprecated{$svtype} && /$deprecated{$svtype}/ ? do { require warnings; warnings::warnif('deprecated', "Attribute \"$1\" is deprecated"); 0; } : 1 } _modify_attrs(@_); } sub import { @_ > 2 && ref $_[2] or do { require Exporter; goto &Exporter::import; }; my (undef,$home_stash,$svref,@attrs) = @_; my $svtype = uc reftype($svref); my $pkgmeth; $pkgmeth = UNIVERSAL::can($home_stash, "MODIFY_${svtype}_ATTRIBUTES") if defined $home_stash && $home_stash ne ''; my @badattrs; if ($pkgmeth) { my @pkgattrs = _modify_attrs_and_deprecate($svtype, $svref, @attrs); @badattrs = $pkgmeth->($home_stash, $svref, @pkgattrs); if (!@badattrs && @pkgattrs) { require warnings; return unless warnings::enabled('reserved'); @pkgattrs = grep { m/\A[[:lower:]]+(?:\z|\()/ } @pkgattrs; if (@pkgattrs) { for my $attr (@pkgattrs) { $attr =~ s/\(.+\z//s; } my $s = ((@pkgattrs == 1) ? '' : 's'); carp "$svtype package attribute$s " . "may clash with future reserved word$s: " . join(' : ' , @pkgattrs); } } } else { @badattrs = _modify_attrs_and_deprecate($svtype, $svref, @attrs); } if (@badattrs) { croak "Invalid $svtype attribute" . (( @badattrs == 1 ) ? '' : 's') . ": " . join(' : ', @badattrs); } } sub get ($) { @_ == 1 && ref $_[0] or croak 'Usage: '.__PACKAGE__.'::get $ref'; my $svref = shift; my $svtype = uc reftype($svref); my $stash = _guess_stash($svref); $stash = caller unless defined $stash; my $pkgmeth; $pkgmeth = UNIVERSAL::can($stash, "FETCH_${svtype}_ATTRIBUTES") if defined $stash && $stash ne ''; return $pkgmeth ? (_fetch_attrs($svref), $pkgmeth->($stash, $svref)) : (_fetch_attrs($svref)) ; } sub require_version { goto &UNIVERSAL::VERSION } require XSLoader; XSLoader::load('attributes', $VERSION); 1; __END__ #The POD goes here #line 491 FILE,bafa70c7/auto/Compress/Raw/Zlib/autosplit.ix#line 1 "/usr/lib/perl5/5.12.2/i686-linux/auto/Compress/Raw/Zlib/autosplit.ix" # Index created by AutoSplit for ../../lib/Compress/Raw/Zlib.pm # (file acts as timestamp) 1; FILE'c604942a/auto/DynaLoader/dl_findfile.al #line 1 "/usr/lib/perl5/5.12.2/i686-linux/auto/DynaLoader/dl_findfile.al" # NOTE: Derived from ../../lib/DynaLoader.pm. # Changes made here will be lost when autosplit is run again. # See AutoSplit.pm. package DynaLoader; #line 239 "../../lib/DynaLoader.pm (autosplit into ../../lib/auto/DynaLoader/dl_findfile.al)" sub dl_findfile { # Read ext/DynaLoader/DynaLoader.doc for detailed information. # This function does not automatically consider the architecture # or the perl library auto directories. my (@args) = @_; my (@dirs, $dir); # which directories to search my (@found); # full paths to real files we have found #my $dl_ext= 'so'; # $Config::Config{'dlext'} suffix for perl extensions #my $dl_so = 'so'; # $Config::Config{'so'} suffix for shared libraries print STDERR "dl_findfile(@args)\n" if $dl_debug; # accumulate directories but process files as they appear arg: foreach(@args) { # Special fast case: full filepath requires no search if (m:/: && -f $_) { push(@found,$_); last arg unless wantarray; next; } # Deal with directories first: # Using a -L prefix is the preferred option (faster and more robust) if (m:^-L:) { s/^-L//; push(@dirs, $_); next; } # Otherwise we try to try to spot directories by a heuristic # (this is a more complicated issue than it first appears) if (m:/: && -d $_) { push(@dirs, $_); next; } # Only files should get this far... my(@names, $name); # what filenames to look for if (m:-l: ) { # convert -lname to appropriate library name s/-l//; push(@names,"lib$_.$dl_so"); push(@names,"lib$_.a"); } else { # Umm, a bare name. Try various alternatives: # these should be ordered with the most likely first push(@names,"$_.$dl_dlext") unless m/\.$dl_dlext$/o; push(@names,"$_.$dl_so") unless m/\.$dl_so$/o; push(@names,"lib$_.$dl_so") unless m:/:; push(@names,"$_.a") if !m/\.a$/ and $dlsrc eq "dl_dld.xs"; push(@names, $_); } my $dirsep = '/'; foreach $dir (@dirs, @dl_library_path) { next unless -d $dir; foreach $name (@names) { my($file) = "$dir$dirsep$name"; print STDERR " checking in $dir for $name\n" if $dl_debug; $file = ($do_expand) ? dl_expandspec($file) : (-f $file && $file); #$file = _check_file($file); if ($file) { push(@found, $file); next arg; # no need to look any further } } } } if ($dl_debug) { foreach(@dirs) { print STDERR " dl_findfile ignored non-existent directory: $_\n" unless -d $_; } print STDERR "dl_findfile found: @found\n"; } return $found[0] unless wantarray; @found; } # end of DynaLoader::dl_findfile 1; FILEa90d4a4d/lib.pm y#line 1 "/usr/lib/perl5/5.12.2/i686-linux/lib.pm" package lib; # THIS FILE IS AUTOMATICALLY GENERATED FROM lib_pm.PL. # ANY CHANGES TO THIS FILE WILL BE OVERWRITTEN BY THE NEXT PERL BUILD. use Config; use strict; my $archname = $Config{archname}; my $version = $Config{version}; my @inc_version_list = reverse split / /, $Config{inc_version_list}; our @ORIG_INC = @INC; # take a handy copy of 'original' value our $VERSION = '0.62'; my $Is_MacOS = $^O eq 'MacOS'; my $Mac_FS; if ($Is_MacOS) { require File::Spec; $Mac_FS = eval { require Mac::FileSpec::Unixish }; } sub import { shift; my %names; foreach (reverse @_) { my $path = $_; # we'll be modifying it, so break the alias if ($path eq '') { require Carp; Carp::carp("Empty compile time value given to use lib"); } $path = _nativize($path); if ($path !~ /\.par$/i && -e $path && ! -d _) { require Carp; Carp::carp("Parameter to use lib must be directory, not file"); } unshift(@INC, $path); # Add any previous version directories we found at configure time foreach my $incver (@inc_version_list) { my $dir = $Is_MacOS ? File::Spec->catdir( $path, $incver ) : "$path/$incver"; unshift(@INC, $dir) if -d $dir; } # Put a corresponding archlib directory in front of $path if it # looks like $path has an archlib directory below it. my($arch_auto_dir, $arch_dir, $version_dir, $version_arch_dir) = _get_dirs($path); unshift(@INC, $arch_dir) if -d $arch_auto_dir; unshift(@INC, $version_dir) if -d $version_dir; unshift(@INC, $version_arch_dir) if -d $version_arch_dir; } # remove trailing duplicates @INC = grep { ++$names{$_} == 1 } @INC; return; } sub unimport { shift; my %names; foreach (@_) { my $path = _nativize($_); my($arch_auto_dir, $arch_dir, $version_dir, $version_arch_dir) = _get_dirs($path); ++$names{$path}; ++$names{$arch_dir} if -d $arch_auto_dir; ++$names{$version_dir} if -d $version_dir; ++$names{$version_arch_dir} if -d $version_arch_dir; } # Remove ALL instances of each named directory. @INC = grep { !exists $names{$_} } @INC; return; } sub _get_dirs { my($dir) = @_; my($arch_auto_dir, $arch_dir, $version_dir, $version_arch_dir); # we could use this for all platforms in the future, but leave it # Mac-only for now, until there is more time for testing it. if ($Is_MacOS) { $arch_auto_dir = File::Spec->catdir( $dir, $archname, 'auto' ); $arch_dir = File::Spec->catdir( $dir, $archname, ); $version_dir = File::Spec->catdir( $dir, $version ); $version_arch_dir = File::Spec->catdir( $dir, $version, $archname ); } else { $arch_auto_dir = "$dir/$archname/auto"; $arch_dir = "$dir/$archname"; $version_dir = "$dir/$version"; $version_arch_dir = "$dir/$version/$archname"; } return($arch_auto_dir, $arch_dir, $version_dir, $version_arch_dir); } sub _nativize { my($dir) = @_; if ($Is_MacOS && $Mac_FS && ! -d $dir) { $dir = Mac::FileSpec::Unixish::nativize($dir); $dir .= ":" unless $dir =~ /:$/; } return $dir; } 1; __END__ #line 243 FILEd78548f0/integer.pm#line 1 "/usr/lib/perl5/5.12.2/integer.pm" package integer; our $VERSION = '1.00'; #line 82 $integer::hint_bits = 0x1; sub import { $^H |= $integer::hint_bits; } sub unimport { $^H &= ~$integer::hint_bits; } 1; FILE0a1552e3/overload.pm#line 1 "/usr/lib/perl5/5.12.2/overload.pm" package overload; our $VERSION = '1.10'; sub nil {} sub OVERLOAD { $package = shift; my %arg = @_; my ($sub, $fb); $ {$package . "::OVERLOAD"}{dummy}++; # Register with magic by touching. $fb = ${$package . "::()"}; # preserve old fallback value RT#68196 *{$package . "::()"} = \&nil; # Make it findable via fetchmethod. for (keys %arg) { if ($_ eq 'fallback') { $fb = $arg{$_}; } else { $sub = $arg{$_}; if (not ref $sub and $sub !~ /::/) { $ {$package . "::(" . $_} = $sub; $sub = \&nil; } #print STDERR "Setting `$ {'package'}::\cO$_' to \\&`$sub'.\n"; *{$package . "::(" . $_} = \&{ $sub }; } } ${$package . "::()"} = $fb; # Make it findable too (fallback only). } sub import { $package = (caller())[0]; # *{$package . "::OVERLOAD"} = \&OVERLOAD; shift; $package->overload::OVERLOAD(@_); } sub unimport { $package = (caller())[0]; ${$package . "::OVERLOAD"}{dummy}++; # Upgrade the table shift; for (@_) { if ($_ eq 'fallback') { undef $ {$package . "::()"}; } else { delete $ {$package . "::"}{"(" . $_}; } } } sub Overloaded { my $package = shift; $package = ref $package if ref $package; $package->can('()'); } sub ov_method { my $globref = shift; return undef unless $globref; my $sub = \&{*$globref}; return $sub if $sub ne \&nil; return shift->can($ {*$globref}); } sub OverloadedStringify { my $package = shift; $package = ref $package if ref $package; #$package->can('(""') ov_method mycan($package, '(""'), $package or ov_method mycan($package, '(0+'), $package or ov_method mycan($package, '(bool'), $package or ov_method mycan($package, '(nomethod'), $package; } sub Method { my $package = shift; if(ref $package) { local $@; local $!; require Scalar::Util; $package = Scalar::Util::blessed($package); return undef if !defined $package; } #my $meth = $package->can('(' . shift); ov_method mycan($package, '(' . shift), $package; #return $meth if $meth ne \&nil; #return $ {*{$meth}}; } sub AddrRef { my $package = ref $_[0]; return "$_[0]" unless $package; local $@; local $!; require Scalar::Util; my $class = Scalar::Util::blessed($_[0]); my $class_prefix = defined($class) ? "$class=" : ""; my $type = Scalar::Util::reftype($_[0]); my $addr = Scalar::Util::refaddr($_[0]); return sprintf("$class_prefix$type(0x%x)", $addr); } *StrVal = *AddrRef; sub mycan { # Real can would leave stubs. my ($package, $meth) = @_; local $@; local $!; require mro; my $mro = mro::get_linear_isa($package); foreach my $p (@$mro) { my $fqmeth = $p . q{::} . $meth; return \*{$fqmeth} if defined &{$fqmeth}; } return undef; } %constants = ( 'integer' => 0x1000, # HINT_NEW_INTEGER 'float' => 0x2000, # HINT_NEW_FLOAT 'binary' => 0x4000, # HINT_NEW_BINARY 'q' => 0x8000, # HINT_NEW_STRING 'qr' => 0x10000, # HINT_NEW_RE ); %ops = ( with_assign => "+ - * / % ** << >> x .", assign => "+= -= *= /= %= **= <<= >>= x= .=", num_comparison => "< <= > >= == !=", '3way_comparison'=> "<=> cmp", str_comparison => "lt le gt ge eq ne", binary => '& &= | |= ^ ^=', unary => "neg ! ~", mutators => '++ --', func => "atan2 cos sin exp abs log sqrt int", conversion => 'bool "" 0+ qr', iterators => '<>', filetest => "-X", dereferencing => '${} @{} %{} &{} *{}', matching => '~~', special => 'nomethod fallback ='); use warnings::register; sub constant { # Arguments: what, sub while (@_) { if (@_ == 1) { warnings::warnif ("Odd number of arguments for overload::constant"); last; } elsif (!exists $constants {$_ [0]}) { warnings::warnif ("`$_[0]' is not an overloadable type"); } elsif (!ref $_ [1] || "$_[1]" !~ /(^|=)CODE\(0x[0-9a-f]+\)$/) { # Can't use C above as code references can be # blessed, and C would return the package the ref is blessed into. if (warnings::enabled) { $_ [1] = "undef" unless defined $_ [1]; warnings::warn ("`$_[1]' is not a code reference"); } } else { $^H{$_[0]} = $_[1]; $^H |= $constants{$_[0]}; } shift, shift; } } sub remove_constant { # Arguments: what, sub while (@_) { delete $^H{$_[0]}; $^H &= ~ $constants{$_[0]}; shift, shift; } } 1; __END__ #line 1534 FILE963adf78/strict.pm#line 1 "/usr/lib/perl5/5.12.2/strict.pm" package strict; $strict::VERSION = "1.04"; # Verify that we're called correctly so that strictures will work. unless ( __FILE__ =~ /(^|[\/\\])\Q${\__PACKAGE__}\E\.pmc?$/ ) { # Can't use Carp, since Carp uses us! my (undef, $f, $l) = caller; die("Incorrect use of pragma '${\__PACKAGE__}' at $f line $l.\n"); } my %bitmask = ( refs => 0x00000002, subs => 0x00000200, vars => 0x00000400 ); sub bits { my $bits = 0; my @wrong; foreach my $s (@_) { push @wrong, $s unless exists $bitmask{$s}; $bits |= $bitmask{$s} || 0; } if (@wrong) { require Carp; Carp::croak("Unknown 'strict' tag(s) '@wrong'"); } $bits; } my $default_bits = bits(qw(refs subs vars)); sub import { shift; $^H |= @_ ? bits(@_) : $default_bits; } sub unimport { shift; $^H &= ~ (@_ ? bits(@_) : $default_bits); } 1; __END__ #line 148 FILE546c8aff/utf8.pm#line 1 "/usr/lib/perl5/5.12.2/utf8.pm" package utf8; $utf8::hint_bits = 0x00800000; our $VERSION = '1.08'; sub import { $^H |= $utf8::hint_bits; $enc{caller()} = $_[1] if $_[1]; } sub unimport { $^H &= ~$utf8::hint_bits; } sub AUTOLOAD { require "utf8_heavy.pl"; goto &$AUTOLOAD if defined &$AUTOLOAD; require Carp; Carp::croak("Undefined subroutine $AUTOLOAD called"); } 1; __END__ #line 215 FILE9cae66c3/vars.pm#line 1 "/usr/lib/perl5/5.12.2/vars.pm" package vars; use 5.006; our $VERSION = '1.01'; use warnings::register; use strict qw(vars subs); sub import { my $callpack = caller; my ($pack, @imports) = @_; my ($sym, $ch); foreach (@imports) { if (($ch, $sym) = /^([\$\@\%\*\&])(.+)/) { if ($sym =~ /\W/) { # time for a more-detailed check-up if ($sym =~ /^\w+[[{].*[]}]$/) { require Carp; Carp::croak("Can't declare individual elements of hash or array"); } elsif (warnings::enabled() and length($sym) == 1 and $sym !~ tr/a-zA-Z//) { warnings::warn("No need to declare built-in vars"); } elsif (($^H &= strict::bits('vars'))) { require Carp; Carp::croak("'$_' is not a valid variable name under strict vars"); } } $sym = "${callpack}::$sym" unless $sym =~ /::/; *$sym = ( $ch eq "\$" ? \$$sym : $ch eq "\@" ? \@$sym : $ch eq "\%" ? \%$sym : $ch eq "\*" ? \*$sym : $ch eq "\&" ? \&$sym : do { require Carp; Carp::croak("'$_' is not a valid variable name"); }); } else { require Carp; Carp::croak("'$_' is not a valid variable name"); } } }; 1; __END__ #line 83 FILE27ae5d52/warnings.pm6#line 1 "/usr/lib/perl5/5.12.2/warnings.pm" # -*- buffer-read-only: t -*- # !!!!!!! DO NOT EDIT THIS FILE !!!!!!! # This file was created by warnings.pl # Any changes made here will be lost. # package warnings; our $VERSION = '1.09'; # Verify that we're called correctly so that warnings will work. # see also strict.pm. unless ( __FILE__ =~ /(^|[\/\\])\Q${\__PACKAGE__}\E\.pmc?$/ ) { my (undef, $f, $l) = caller; die("Incorrect use of pragma '${\__PACKAGE__}' at $f line $l.\n"); } #line 161 our %Offsets = ( # Warnings Categories added in Perl 5.008 'all' => 0, 'closure' => 2, 'deprecated' => 4, 'exiting' => 6, 'glob' => 8, 'io' => 10, 'closed' => 12, 'exec' => 14, 'layer' => 16, 'newline' => 18, 'pipe' => 20, 'unopened' => 22, 'misc' => 24, 'numeric' => 26, 'once' => 28, 'overflow' => 30, 'pack' => 32, 'portable' => 34, 'recursion' => 36, 'redefine' => 38, 'regexp' => 40, 'severe' => 42, 'debugging' => 44, 'inplace' => 46, 'internal' => 48, 'malloc' => 50, 'signal' => 52, 'substr' => 54, 'syntax' => 56, 'ambiguous' => 58, 'bareword' => 60, 'digit' => 62, 'parenthesis' => 64, 'precedence' => 66, 'printf' => 68, 'prototype' => 70, 'qw' => 72, 'reserved' => 74, 'semicolon' => 76, 'taint' => 78, 'threads' => 80, 'uninitialized' => 82, 'unpack' => 84, 'untie' => 86, 'utf8' => 88, 'void' => 90, # Warnings Categories added in Perl 5.011 'imprecision' => 92, 'illegalproto' => 94, ); our %Bits = ( 'all' => "\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55", # [0..47] 'ambiguous' => "\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00", # [29] 'bareword' => "\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00", # [30] 'closed' => "\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [6] 'closure' => "\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [1] 'debugging' => "\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00", # [22] 'deprecated' => "\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [2] 'digit' => "\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00", # [31] 'exec' => "\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [7] 'exiting' => "\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [3] 'glob' => "\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [4] 'illegalproto' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40", # [47] 'imprecision' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10", # [46] 'inplace' => "\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00", # [23] 'internal' => "\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00", # [24] 'io' => "\x00\x54\x55\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [5..11] 'layer' => "\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [8] 'malloc' => "\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00", # [25] 'misc' => "\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00", # [12] 'newline' => "\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [9] 'numeric' => "\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00", # [13] 'once' => "\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00", # [14] 'overflow' => "\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00", # [15] 'pack' => "\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00", # [16] 'parenthesis' => "\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00", # [32] 'pipe' => "\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [10] 'portable' => "\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00", # [17] 'precedence' => "\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00", # [33] 'printf' => "\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00", # [34] 'prototype' => "\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00", # [35] 'qw' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00", # [36] 'recursion' => "\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00", # [18] 'redefine' => "\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00", # [19] 'regexp' => "\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00", # [20] 'reserved' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00", # [37] 'semicolon' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00", # [38] 'severe' => "\x00\x00\x00\x00\x00\x54\x05\x00\x00\x00\x00\x00", # [21..25] 'signal' => "\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00", # [26] 'substr' => "\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00", # [27] 'syntax' => "\x00\x00\x00\x00\x00\x00\x00\x55\x55\x15\x00\x40", # [28..38,47] 'taint' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00", # [39] 'threads' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00", # [40] 'uninitialized' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00", # [41] 'unopened' => "\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [11] 'unpack' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00", # [42] 'untie' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00", # [43] 'utf8' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01", # [44] 'void' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04", # [45] ); our %DeadBits = ( 'all' => "\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa", # [0..47] 'ambiguous' => "\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00", # [29] 'bareword' => "\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00", # [30] 'closed' => "\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [6] 'closure' => "\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [1] 'debugging' => "\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00", # [22] 'deprecated' => "\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [2] 'digit' => "\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00", # [31] 'exec' => "\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [7] 'exiting' => "\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [3] 'glob' => "\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [4] 'illegalproto' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80", # [47] 'imprecision' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20", # [46] 'inplace' => "\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00", # [23] 'internal' => "\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00", # [24] 'io' => "\x00\xa8\xaa\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [5..11] 'layer' => "\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [8] 'malloc' => "\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00", # [25] 'misc' => "\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00", # [12] 'newline' => "\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [9] 'numeric' => "\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00", # [13] 'once' => "\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00", # [14] 'overflow' => "\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00", # [15] 'pack' => "\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00", # [16] 'parenthesis' => "\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00", # [32] 'pipe' => "\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [10] 'portable' => "\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00", # [17] 'precedence' => "\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00", # [33] 'printf' => "\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00", # [34] 'prototype' => "\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00", # [35] 'qw' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00", # [36] 'recursion' => "\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00", # [18] 'redefine' => "\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00", # [19] 'regexp' => "\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00", # [20] 'reserved' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00", # [37] 'semicolon' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00", # [38] 'severe' => "\x00\x00\x00\x00\x00\xa8\x0a\x00\x00\x00\x00\x00", # [21..25] 'signal' => "\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00", # [26] 'substr' => "\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00", # [27] 'syntax' => "\x00\x00\x00\x00\x00\x00\x00\xaa\xaa\x2a\x00\x80", # [28..38,47] 'taint' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00", # [39] 'threads' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00", # [40] 'uninitialized' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00", # [41] 'unopened' => "\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [11] 'unpack' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00", # [42] 'untie' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00", # [43] 'utf8' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02", # [44] 'void' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08", # [45] ); $NONE = "\0\0\0\0\0\0\0\0\0\0\0\0"; $LAST_BIT = 96 ; $BYTES = 12 ; $All = "" ; vec($All, $Offsets{'all'}, 2) = 3 ; sub Croaker { require Carp; # this initializes %CarpInternal local $Carp::CarpInternal{'warnings'}; delete $Carp::CarpInternal{'warnings'}; Carp::croak(@_); } sub bits { # called from B::Deparse.pm push @_, 'all' unless @_; my $mask; my $catmask ; my $fatal = 0 ; my $no_fatal = 0 ; foreach my $word ( @_ ) { if ($word eq 'FATAL') { $fatal = 1; $no_fatal = 0; } elsif ($word eq 'NONFATAL') { $fatal = 0; $no_fatal = 1; } elsif ($catmask = $Bits{$word}) { $mask |= $catmask ; $mask |= $DeadBits{$word} if $fatal ; $mask &= ~($DeadBits{$word}|$All) if $no_fatal ; } else { Croaker("Unknown warnings category '$word'")} } return $mask ; } sub import { shift; my $catmask ; my $fatal = 0 ; my $no_fatal = 0 ; my $mask = ${^WARNING_BITS} ; if (vec($mask, $Offsets{'all'}, 1)) { $mask |= $Bits{'all'} ; $mask |= $DeadBits{'all'} if vec($mask, $Offsets{'all'}+1, 1); } push @_, 'all' unless @_; foreach my $word ( @_ ) { if ($word eq 'FATAL') { $fatal = 1; $no_fatal = 0; } elsif ($word eq 'NONFATAL') { $fatal = 0; $no_fatal = 1; } elsif ($catmask = $Bits{$word}) { $mask |= $catmask ; $mask |= $DeadBits{$word} if $fatal ; $mask &= ~($DeadBits{$word}|$All) if $no_fatal ; } else { Croaker("Unknown warnings category '$word'")} } ${^WARNING_BITS} = $mask ; } sub unimport { shift; my $catmask ; my $mask = ${^WARNING_BITS} ; if (vec($mask, $Offsets{'all'}, 1)) { $mask |= $Bits{'all'} ; $mask |= $DeadBits{'all'} if vec($mask, $Offsets{'all'}+1, 1); } push @_, 'all' unless @_; foreach my $word ( @_ ) { if ($word eq 'FATAL') { next; } elsif ($catmask = $Bits{$word}) { $mask &= ~($catmask | $DeadBits{$word} | $All); } else { Croaker("Unknown warnings category '$word'")} } ${^WARNING_BITS} = $mask ; } my %builtin_type; @builtin_type{qw(SCALAR ARRAY HASH CODE REF GLOB LVALUE Regexp)} = (); sub __chk { my $category ; my $offset ; my $isobj = 0 ; if (@_) { # check the category supplied. $category = shift ; if (my $type = ref $category) { Croaker("not an object") if exists $builtin_type{$type}; $category = $type; $isobj = 1 ; } $offset = $Offsets{$category}; Croaker("Unknown warnings category '$category'") unless defined $offset; } else { $category = (caller(1))[0] ; $offset = $Offsets{$category}; Croaker("package '$category' not registered for warnings") unless defined $offset ; } my $this_pkg = (caller(1))[0] ; my $i = 2 ; my $pkg ; if ($isobj) { while (do { { package DB; $pkg = (caller($i++))[0] } } ) { last unless @DB::args && $DB::args[0] =~ /^$category=/ ; } $i -= 2 ; } else { $i = _error_loc(); # see where Carp will allocate the error } my $callers_bitmask = (caller($i))[9] ; return ($callers_bitmask, $offset, $i) ; } sub _error_loc { require Carp; goto &Carp::short_error_loc; # don't introduce another stack frame } sub enabled { Croaker("Usage: warnings::enabled([category])") unless @_ == 1 || @_ == 0 ; my ($callers_bitmask, $offset, $i) = __chk(@_) ; return 0 unless defined $callers_bitmask ; return vec($callers_bitmask, $offset, 1) || vec($callers_bitmask, $Offsets{'all'}, 1) ; } sub fatal_enabled { Croaker("Usage: warnings::fatal_enabled([category])") unless @_ == 1 || @_ == 0 ; my ($callers_bitmask, $offset, $i) = __chk(@_) ; return 0 unless defined $callers_bitmask; return vec($callers_bitmask, $offset + 1, 1) || vec($callers_bitmask, $Offsets{'all'} + 1, 1) ; } sub warn { Croaker("Usage: warnings::warn([category,] 'message')") unless @_ == 2 || @_ == 1 ; my $message = pop ; my ($callers_bitmask, $offset, $i) = __chk(@_) ; require Carp; Carp::croak($message) if vec($callers_bitmask, $offset+1, 1) || vec($callers_bitmask, $Offsets{'all'}+1, 1) ; Carp::carp($message) ; } sub warnif { Croaker("Usage: warnings::warnif([category,] 'message')") unless @_ == 2 || @_ == 1 ; my $message = pop ; my ($callers_bitmask, $offset, $i) = __chk(@_) ; return unless defined $callers_bitmask && (vec($callers_bitmask, $offset, 1) || vec($callers_bitmask, $Offsets{'all'}, 1)) ; require Carp; Carp::croak($message) if vec($callers_bitmask, $offset+1, 1) || vec($callers_bitmask, $Offsets{'all'}+1, 1) ; Carp::carp($message) ; } 1; # ex: set ro: FILE33104b31/warnings/register.pm#line 1 "/usr/lib/perl5/5.12.2/warnings/register.pm" package warnings::register; our $VERSION = '1.01'; #line 23 require warnings; sub mkMask { my ($bit) = @_; my $mask = ""; vec($mask, $bit, 1) = 1; return $mask; } sub import { shift; my $package = (caller(0))[0]; if (! defined $warnings::Bits{$package}) { $warnings::Bits{$package} = mkMask($warnings::LAST_BIT); vec($warnings::Bits{'all'}, $warnings::LAST_BIT, 1) = 1; $warnings::Offsets{$package} = $warnings::LAST_BIT ++; foreach my $k (keys %warnings::Bits) { vec($warnings::Bits{$k}, $warnings::LAST_BIT, 1) = 0; } $warnings::DeadBits{$package} = mkMask($warnings::LAST_BIT); vec($warnings::DeadBits{'all'}, $warnings::LAST_BIT++, 1) = 1; } } 1; FILE99b78ac6/PAR.pmo#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR.pm" package PAR; $PAR::VERSION = '1.002'; use 5.006; use strict; use warnings; use Config '%Config'; use Carp qw/croak/; # If the 'prefork' module is available, we # register various run-time loaded modules with it. # That way, there is more shared memory in a forking # environment. BEGIN { if (eval 'require prefork') { prefork->import($_) for qw/ Archive::Zip File::Glob File::Spec File::Temp LWP::Simple PAR::Heavy /; # not including Archive::Unzip::Burst which only makes sense # in the context of a PAR::Packer'ed executable anyway. } } use PAR::SetupProgname; use PAR::SetupTemp; #line 311 use vars qw(@PAR_INC); # explicitly stated PAR library files (preferred) use vars qw(@PAR_INC_LAST); # explicitly stated PAR library files (fallback) use vars qw(%PAR_INC); # sets {$par}{$file} for require'd modules use vars qw(@LibCache %LibCache); # I really miss pseudohash. use vars qw($LastAccessedPAR $LastTempFile); use vars qw(@RepositoryObjects); # If we have PAR::Repository::Client support, we # put the ::Client objects in here. use vars qw(@PriorityRepositoryObjects); # repositories which are preferred over local stuff use vars qw(@UpgradeRepositoryObjects); # If we have PAR::Repository::Client's in upgrade mode # put the ::Client objects in here *as well*. use vars qw(%FileCache); # The Zip-file file-name-cache # Layout: # $FileCache{$ZipObj}{$FileName} = $Member use vars qw(%ArchivesExtracted); # Associates archive-zip-object => full extraction path my $ver = $Config{version}; my $arch = $Config{archname}; my $progname = $ENV{PAR_PROGNAME} || $0; my $is_insensitive_fs = ( -s $progname and (-s lc($progname) || -1) == (-s uc($progname) || -1) and (-s lc($progname) || -1) == -s $progname ); # lexical for import(), and _import_foo() functions to control unpar() my %unpar_options; # called on "use PAR" sub import { my $class = shift; PAR::SetupProgname::set_progname(); PAR::SetupTemp::set_par_temp_env(); $progname = $ENV{PAR_PROGNAME} ||= $0; $is_insensitive_fs = (-s $progname and (-s lc($progname) || -1) == (-s uc($progname) || -1)); my @args = @_; # Insert PAR hook in @INC. unshift @INC, \&find_par unless grep { $_ eq \&find_par } @INC; push @INC, \&find_par_last unless grep { $_ eq \&find_par_last } @INC; # process args to use PAR 'foo.par', { opts }, ...; foreach my $par (@args) { if (ref($par) eq 'HASH') { # we have been passed a hash reference _import_hash_ref($par); } elsif ($par =~ /[?*{}\[\]]/) { # implement globbing for PAR archives require File::Glob; foreach my $matched (File::Glob::glob($par)) { push @PAR_INC, unpar($matched, undef, undef, 1); } } else { # ordinary string argument => file push @PAR_INC, unpar($par, undef, undef, 1); } } return if $PAR::__import; local $PAR::__import = 1; require PAR::Heavy; PAR::Heavy::_init_dynaloader(); # The following code is executed for the case where the # running program is itself a PAR archive. # ==> run script/main.pl if (unpar($progname)) { # XXX - handle META.yml here! push @PAR_INC, unpar($progname, undef, undef, 1); _extract_inc($progname) unless $ENV{PAR_CLEAN}; if ($LibCache{$progname}) { # XXX bad: this us just a good guess require File::Spec; $ArchivesExtracted{$progname} = File::Spec->catdir($ENV{PAR_TEMP}, 'inc'); } my $zip = $LibCache{$progname}; my $member = _first_member( $zip, "script/main.pl", "main.pl", ); if ($progname and !$member) { require File::Spec; my @path = File::Spec->splitdir($progname); my $filename = pop @path; $member = _first_member( $zip, "script/".$filename, "script/".$filename.".pl", $filename, $filename.".pl", ) } # finally take $ARGV[0] as the hint for file to run if (defined $ARGV[0] and !$member) { $member = _first_member( $zip, "script/$ARGV[0]", "script/$ARGV[0].pl", $ARGV[0], "$ARGV[0].pl", ) or die qq(PAR.pm: Can't open perl script "$ARGV[0]": No such file or directory); shift @ARGV; } if (!$member) { die "Usage: $0 script_file_name.\n"; } _run_member($member); } } # import() helper for the "use PAR {...};" syntax. sub _import_hash_ref { my $opt = shift; # hash slice assignment -- pass all of the options into unpar local @unpar_options{keys(%$opt)} = values(%$opt); # check for incompatible options: if ( exists $opt->{repository} and exists $opt->{file} ) { croak("Invalid PAR loading options. Cannot have a 'repository' and 'file' option at the same time."); } elsif ( exists $opt->{file} and (exists $opt->{install} or exists $opt->{upgrade}) ) { my $e = exists($opt->{install}) ? 'install' : 'upgrade'; croak("Invalid PAR loading options. Cannot combine 'file' and '$e' options."); } elsif ( not exists $opt->{repository} and not exists $opt->{file} ) { croak("Invalid PAR loading options. Need at least one of 'file' or 'repository' options."); } # load from file if (exists $opt->{file}) { croak("Cannot load undefined PAR archive") if not defined $opt->{file}; # for files, we default to loading from PAR archive first my $fallback = $opt->{fallback}; $fallback = 0 if not defined $fallback; if (not $fallback) { # load from this PAR arch preferably push @PAR_INC, unpar($opt->{file}, undef, undef, 1); } else { # load from this PAR arch as fallback push @PAR_INC_LAST, unpar($opt->{file}, undef, undef, 1); } } else { # Deal with repositories elsewhere my $client = _import_repository($opt); return() if not $client; if (defined $opt->{run}) { # run was specified # run the specified script from the repository $client->run_script( $opt->{run} ); return 1; } return 1; } # run was specified # run the specified script from inside the PAR file. if (defined $opt->{run}) { my $script = $opt->{run}; require PAR::Heavy; PAR::Heavy::_init_dynaloader(); # XXX - handle META.yml here! _extract_inc($opt->{file}) unless $ENV{PAR_CLEAN}; my $zip = $LibCache{$opt->{file}}; my $member = _first_member( $zip, (($script !~ /^script\//) ? ("script/$script", "script/$script.pl") : ()), $script, "$script.pl", ); if (not defined $member) { croak("Cannot run script '$script' from PAR file '$opt->{file}'. Script couldn't be found in PAR file."); } _run_member_from_par($member); } return(); } # This sub is invoked by _import_hash_ref if a {repository} # option is found # Returns the repository client object on success. sub _import_repository { my $opt = shift; my $url = $opt->{repository}; eval "require PAR::Repository::Client; 1;"; if ($@ or not eval PAR::Repository::Client->VERSION >= 0.04) { croak "In order to use the 'use PAR { repository => 'url' };' syntax, you need to install the PAR::Repository::Client module (version 0.04 or later) from CPAN. This module does not seem to be installed as indicated by the following error message: $@"; } if ($opt->{upgrade} and not eval PAR::Repository::Client->VERSION >= 0.22) { croak "In order to use the 'upgrade' option, you need to install the PAR::Repository::Client module (version 0.22 or later) from CPAN"; } if ($opt->{dependencies} and not eval PAR::Repository::Client->VERSION >= 0.23) { croak "In order to use the 'dependencies' option, you need to install the PAR::Repository::Client module (version 0.23 or later) from CPAN"; } my $obj; # Support existing clients passed in as objects. if (ref($url) and UNIVERSAL::isa($obj, 'PAR::Repository::Client')) { $obj = $url; } else { $obj = PAR::Repository::Client->new( uri => $url, auto_install => $opt->{install}, auto_upgrade => $opt->{upgrade}, static_dependencies => $opt->{dependencies}, ); } if (exists($opt->{fallback}) and not $opt->{fallback}) { push @PriorityRepositoryObjects, $obj; # repository beats local stuff } else { push @RepositoryObjects, $obj; # local stuff beats repository } # these are tracked separately so we can check for upgrades early push @UpgradeRepositoryObjects, $obj if $opt->{upgrade}; return $obj; } # Given an Archive::Zip obj and a list of files/paths, # this function returns the Archive::Zip::Member for the # first of the files found in the ZIP. If none is found, # returns the empty list. sub _first_member { my $zip = shift; foreach my $name (@_) { my $member = _cached_member_named($zip, $name); return $member if $member; } return; } # Given an Archive::Zip object, this finds the first # Archive::Zip member whose file name matches the # regular expression sub _first_member_matching { my $zip = shift; my $regex = shift; my $cache = $FileCache{$zip}; $cache = $FileCache{$zip} = _make_file_cache($zip) if not $cache; foreach my $name (keys %$cache) { if ($name =~ $regex) { return $cache->{$name}; } } return(); } sub _run_member_from_par { my $member = shift; my $clear_stack = shift; my ($fh, $is_new, $filename) = _tempfile($member->crc32String . ".pl"); if ($is_new) { my $file = $member->fileName; print $fh "package main;\n"; print $fh "#line 1 \"$file\"\n"; $member->extractToFileHandle($fh); seek ($fh, 0, 0); } $ENV{PAR_0} = $filename; # for Pod::Usage { do $filename; CORE::exit($1) if ($@ =~/^_TK_EXIT_\((\d+)\)/); die $@ if $@; exit; } } sub _run_member { my $member = shift; my $clear_stack = shift; my ($fh, $is_new, $filename) = _tempfile($member->crc32String . ".pl"); if ($is_new) { my $file = $member->fileName; print $fh "package main; shift \@INC;\n"; if (defined &Internals::PAR::CLEARSTACK and $clear_stack) { print $fh "Internals::PAR::CLEARSTACK();\n"; } print $fh "#line 1 \"$file\"\n"; $member->extractToFileHandle($fh); seek ($fh, 0, 0); } unshift @INC, sub { $fh }; $ENV{PAR_0} = $filename; # for Pod::Usage { do 'main'; CORE::exit($1) if ($@ =~/^_TK_EXIT_\((\d+)\)/); die $@ if $@; exit; } } sub _run_external_file { my $filename = shift; my $clear_stack = shift; require 5.008; open my $ffh, '<', $filename or die "Can't open perl script \"$filename\": $!"; my $clearstack = ''; if (defined &Internals::PAR::CLEARSTACK and $clear_stack) { $clear_stack = "Internals::PAR::CLEARSTACK();\n"; } my $string = "package main; shift \@INC;\n$clearstack#line 1 \"$filename\"\n" . do { local $/ = undef; <$ffh> }; close $ffh; open my $fh, '<', \$string or die "Can't open file handle to string: $!"; unshift @INC, sub { $fh }; $ENV{PAR_0} = $filename; # for Pod::Usage { do 'main'; CORE::exit($1) if ($@ =~/^_TK_EXIT_\((\d+)\)/); die $@ if $@; exit; } } # extract the contents of a .par (or .exe) or any # Archive::Zip handle to the PAR_TEMP/inc directory. # returns that directory. sub _extract_inc { my $file_or_azip_handle = shift; my $force_extract = shift; my $inc = "$PAR::SetupTemp::PARTemp/inc"; my $dlext = defined($Config{dlext}) ? $Config::Config{dlext} : ''; my $inc_exists = -d $inc; my $is_handle = ref($file_or_azip_handle) && $file_or_azip_handle->isa('Archive::Zip::Archive'); require File::Spec; if (!$inc_exists or $force_extract) { for (1 .. 10) { mkdir("$inc.lock", 0755) and last; sleep 1 } undef $@; if (!$is_handle) { # First try to unzip the *fast* way. eval { require Archive::Unzip::Burst; Archive::Unzip::Burst::unzip($file_or_azip_handle, $inc) and die "Could not unzip '$file_or_azip_handle' into '$inc'. Error: $!"; die; }; # This means the fast module is there, but didn't work. if ($@ =~ /^Could not unzip/) { die $@; } } # either failed to load Archive::Unzip::Burst or got an A::Zip handle # fallback to slow way. if ($is_handle || $@) { my $zip; if (!$is_handle) { open my $fh, '<', $file_or_azip_handle or die "Cannot find '$file_or_azip_handle': $!"; binmode($fh); bless($fh, 'IO::File'); $zip = Archive::Zip->new; ( $zip->readFromFileHandle($fh, $file_or_azip_handle) == Archive::Zip::AZ_OK() ) or die "Read '$file_or_azip_handle' error: $!"; } else { $zip = $file_or_azip_handle; } mkdir($inc) if not -d $inc; for ( $zip->memberNames() ) { s{^/}{}; # Skip DLLs (these will be handled by the dynaloader hook) # except for those placed in File::ShareDir directories. next if (m{\.\Q$dlext\E[^/]*$} && !m{^lib/auto/share/(dist|module)/}); my $outfile = File::Spec->catfile($inc, $_); next if -e $outfile and not -w _; $zip->extractMember($_, "$inc/" . $_); } } rmdir("$inc.lock"); $ArchivesExtracted{$is_handle ? $file_or_azip_handle->fileName() : $file_or_azip_handle} = $inc; } # add the freshly extracted directories to @INC, # but make sure there's no duplicates my %inc_exists = map { ($_, 1) } @INC; unshift @INC, grep !exists($inc_exists{$_}), grep -d, map File::Spec->catdir($inc, @$_), [ 'lib' ], [ 'arch' ], [ $arch ], [ $ver ], [ $ver, $arch ], []; return $inc; } # This is the hook placed in @INC for loading PAR's # before any other stuff in @INC sub find_par { my @args = @_; # if there are repositories in upgrade mode, check them # first. If so, this is expensive, of course! if (@UpgradeRepositoryObjects) { my $module = $args[1]; $module =~ s/\.pm$//; $module =~ s/\//::/g; foreach my $client (@UpgradeRepositoryObjects) { my $local_file = $client->upgrade_module($module); # break the require if upgrade_module has been required already # to avoid infinite recursion if (exists $INC{$args[1]}) { # Oh dear. Check for the possible return values of the INC sub hooks in # perldoc -f require before trying to understand this. # Then, realize that if you pass undef for the file handle, perl (5.8.9) # does NOT use the subroutine. Thus the hacky GLOB ref. my $line = 1; no warnings; return (\*I_AM_NOT_HERE, sub {$line ? ($_="1;",$line=0,return(1)) : ($_="",return(0))}); } # Note: This is likely not necessary as the module has been installed # into the system by upgrade_module if it was available at all. # If it was already loaded, this will not be reached (see return right above). # If it could not be loaded from the system and neither found in the repository, # we simply want to have the normal error message, too! # #if ($local_file) { # # XXX load with fallback - is that right? # return _find_par_internals([$PAR_INC_LAST[-1]], @args); #} } } my $rv = _find_par_internals(\@PAR_INC, @args); return $rv if defined $rv or not @PriorityRepositoryObjects; # the repositories that are prefered over locally installed modules my $module = $args[1]; $module =~ s/\.pm$//; $module =~ s/\//::/g; foreach my $client (@PriorityRepositoryObjects) { my $local_file = $client->get_module($module, 0); # 1 == fallback if ($local_file) { # Not loaded as fallback (cf. PRIORITY) thus look at PAR_INC # instead of PAR_INC_LAST return _find_par_internals([$PAR_INC[-1]], @args); } } return(); } # This is the hook placed in @INC for loading PAR's # AFTER any other stuff in @INC # It also deals with loading from repositories as a # fallback-fallback ;) sub find_par_last { my @args = @_; # Try the local PAR files first my $rv = _find_par_internals(\@PAR_INC_LAST, @args); return $rv if defined $rv; # No repositories => return return $rv if not @RepositoryObjects; my $module = $args[1]; $module =~ s/\.pm$//; $module =~ s/\//::/g; foreach my $client (@RepositoryObjects) { my $local_file = $client->get_module($module, 1); # 1 == fallback if ($local_file) { # Loaded as fallback thus look at PAR_INC_LAST return _find_par_internals([$PAR_INC_LAST[-1]], @args); } } return $rv; } # This routine implements loading modules from PARs # both for loading PARs preferably or as fallback. # To distinguish the cases, the first parameter should # be a reference to the corresponding @PAR_INC* array. sub _find_par_internals { my ($INC_ARY, $self, $file, $member_only) = @_; my $scheme; foreach (@$INC_ARY ? @$INC_ARY : @INC) { my $path = $_; if ($] < 5.008001) { # reassemble from "perl -Ischeme://path" autosplitting $path = "$scheme:$path" if !@$INC_ARY and $path and $path =~ m!//! and $scheme and $scheme =~ /^\w+$/; $scheme = $path; } my $rv = unpar($path, $file, $member_only, 1) or next; $PAR_INC{$path}{$file} = 1; $INC{$file} = $LastTempFile if (lc($file) =~ /^(?!tk).*\.pm$/); return $rv; } return; } sub reload_libs { my @par_files = @_; @par_files = sort keys %LibCache unless @par_files; foreach my $par (@par_files) { my $inc_ref = $PAR_INC{$par} or next; delete $LibCache{$par}; delete $FileCache{$par}; foreach my $file (sort keys %$inc_ref) { delete $INC{$file}; require $file; } } } #sub find_zip_member { # my $file = pop; # # foreach my $zip (@LibCache) { # my $member = _first_member($zip, $file) or next; # return $member; # } # # return; #} sub read_file { my $file = pop; foreach my $zip (@LibCache) { my $member = _first_member($zip, $file) or next; return scalar $member->contents; } return; } sub par_handle { my $par = pop; return $LibCache{$par}; } my %escapes; sub unpar { my ($par, $file, $member_only, $allow_other_ext) = @_; return if not defined $par; my $zip = $LibCache{$par}; my @rv = $par; # a guard against (currently unimplemented) recursion return if $PAR::__unpar; local $PAR::__unpar = 1; unless ($zip) { # URL use case ==> download if ($par =~ m!^\w+://!) { require File::Spec; require LWP::Simple; # reflector support $par .= "pm=$file" if $par =~ /[?&;]/; # prepare cache directory $ENV{PAR_CACHE} ||= '_par'; mkdir $ENV{PAR_CACHE}, 0777; if (!-d $ENV{PAR_CACHE}) { $ENV{PAR_CACHE} = File::Spec->catdir(File::Spec->tmpdir, 'par'); mkdir $ENV{PAR_CACHE}, 0777; return unless -d $ENV{PAR_CACHE}; } # Munge URL into local file name # FIXME: This might result in unbelievably long file names! # I have run into the file/path length limitations of linux # with similar code in PAR::Repository::Client. # I suspect this is even worse on Win32. # -- Steffen my $file = $par; if (!%escapes) { $escapes{chr($_)} = sprintf("%%%02X", $_) for 0..255; } { use bytes; $file =~ s/([^\w\.])/$escapes{$1}/g; } $file = File::Spec->catfile( $ENV{PAR_CACHE}, $file); LWP::Simple::mirror( $par, $file ); return unless -e $file and -f _; $par = $file; } # Got the .par as a string. (reference to scalar, of course) elsif (ref($par) eq 'SCALAR') { my ($fh) = _tempfile(); print $fh $$par; $par = $fh; } # If the par is not a valid .par file name and we're being strict # about this, then also check whether "$par.par" exists elsif (!(($allow_other_ext or $par =~ /\.par\z/i) and -f $par)) { $par .= ".par"; return unless -f $par; } require Archive::Zip; $zip = Archive::Zip->new; my @file; if (!ref $par) { @file = $par; open my $fh, '<', $par; binmode($fh); $par = $fh; bless($par, 'IO::File'); } Archive::Zip::setErrorHandler(sub {}); my $rv = $zip->readFromFileHandle($par, @file); Archive::Zip::setErrorHandler(undef); return unless $rv == Archive::Zip::AZ_OK(); push @LibCache, $zip; $LibCache{$_[0]} = $zip; $FileCache{$_[0]} = _make_file_cache($zip); # only recursive case -- appears to be unused and unimplemented foreach my $member ( _cached_members_matching($zip, "^par/(?:$Config{version}/)?(?:$Config{archname}/)?" ) ) { next if $member->isDirectory; my $content = $member->contents(); next unless $content =~ /^PK\003\004/; push @rv, unpar(\$content, undef, undef, 1); } # extract all shlib dlls from the .par to $ENV{PAR_TEMP} # Intended to fix problem with Alien::wxWidgets/Wx... # NOTE auto/foo/foo.so|dll will get handled by the dynaloader # hook, so no need to pull it out here. # Allow this to be disabled so caller can do their own caching # via import({no_shlib_unpack => 1, file => foo.par}) if(not $unpar_options{no_shlib_unpack} and defined $ENV{PAR_TEMP}) { my @members = _cached_members_matching( $zip, qr#^shlib/$Config{archname}/.*\.\Q$Config{dlext}\E(?:\.|$)# ); foreach my $member (@members) { next if $member->isDirectory; my $member_name = $member->fileName; next unless $member_name =~ m{ \/([^/]+)$ }x or $member_name =~ m{ ^([^/]+)$ }; my $extract_name = $1; my $dest_name = File::Spec->catfile($ENV{PAR_TEMP}, $extract_name); # but don't extract it if we've already got one $member->extractToFileNamed($dest_name) unless(-e $dest_name); } } # Now push this path into usual library search paths my $separator = $Config{path_sep}; my $tempdir = $ENV{PAR_TEMP}; foreach my $key (qw( LD_LIBRARY_PATH LIB_PATH LIBRARY_PATH PATH DYLD_LIBRARY_PATH )) { if (defined $ENV{$key} and $ENV{$key} ne '') { # Check whether it's already in the path. If so, don't # append the PAR temp dir in order not to overflow the # maximum length for ENV vars. $ENV{$key} .= $separator . $tempdir unless grep { $_ eq $tempdir } split $separator, $ENV{$key}; } else { $ENV{$key} = $tempdir; } } } $LastAccessedPAR = $zip; return @rv unless defined $file; my $member = _first_member($zip, "lib/$file", "arch/$file", "$arch/$file", "$ver/$file", "$ver/$arch/$file", $file, ) or return; return $member if $member_only; my ($fh, $is_new); ($fh, $is_new, $LastTempFile) = _tempfile($member->crc32String . ".pm"); die "Bad Things Happened..." unless $fh; if ($is_new) { $member->extractToFileHandle($fh); seek ($fh, 0, 0); } return $fh; } sub _tempfile { my ($fh, $filename); if ($ENV{PAR_CLEAN} or !@_) { require File::Temp; if (defined &File::Temp::tempfile) { # under Win32, the file is created with O_TEMPORARY, # and will be deleted by the C runtime; having File::Temp # delete it has the only effect of giving ugly warnings ($fh, $filename) = File::Temp::tempfile( DIR => $PAR::SetupTemp::PARTemp, UNLINK => ($^O ne 'MSWin32' and $^O !~ /hpux/), ) or die "Cannot create temporary file: $!"; binmode($fh); return ($fh, 1, $filename); } } require File::Spec; # untainting tempfile path local $_ = File::Spec->catfile( $PAR::SetupTemp::PARTemp, $_[0] ); /^(.+)$/ and $filename = $1; if (-r $filename) { open $fh, '<', $filename or die $!; binmode($fh); return ($fh, 0, $filename); } open $fh, '+>', $filename or die $!; binmode($fh); return ($fh, 1, $filename); } # Given an Archive::Zip object, this generates a hash of # file_name_in_zip => file object # and returns a reference to that. # If we broke the encapsulation of A::Zip::Member and # accessed $member->{fileName} directly, that would be # *significantly* faster. sub _make_file_cache { my $zip = shift; if (not ref($zip)) { croak("_make_file_cache needs an Archive::Zip object as argument."); } my $cache = {}; foreach my $member ($zip->members) { $cache->{$member->fileName()} = $member; } return $cache; } # given an Archive::Zip object, this finds the cached hash # of Archive::Zip member names => members, # and returns all member objects whose file names match # a regexp # Without file caching, it just uses $zip->membersMatching sub _cached_members_matching { my $zip = shift; my $regex = shift; my $cache = $FileCache{$zip}; $cache = $FileCache{$zip} = _make_file_cache($zip) if not $cache; return map {$cache->{$_}} grep { $_ =~ $regex } keys %$cache; } # access named zip file member through cache. Fall # back to using Archive::Zip (slow) sub _cached_member_named { my $zip = shift; my $name = shift; my $cache = $FileCache{$zip}; $cache = $FileCache{$zip} = _make_file_cache($zip) if not $cache; return $cache->{$name}; } # Attempt to clean up the temporary directory if # --> We're running in clean mode # --> It's defined # --> It's an existing directory # --> It's empty END { if (exists $ENV{PAR_CLEAN} and $ENV{PAR_CLEAN} and exists $ENV{PAR_TEMP} and defined $ENV{PAR_TEMP} and -d $ENV{PAR_TEMP} ) { local($!); # paranoid: ignore potential errors without clobbering a global variable! rmdir($ENV{PAR_TEMP}); } } 1; __END__ #line 1249 FILE5cb23187/PAR/Dist.pmw#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/Dist.pm" package PAR::Dist; use 5.006; use strict; require Exporter; use vars qw/$VERSION @ISA @EXPORT @EXPORT_OK $DEBUG/; $VERSION = '0.47'; # Change version in POD, too! @ISA = 'Exporter'; @EXPORT = qw/ blib_to_par install_par uninstall_par sign_par verify_par merge_par remove_man get_meta generate_blib_stub /; @EXPORT_OK = qw/ parse_dist_name contains_binaries /; $DEBUG = 0; use Carp qw/carp croak/; use File::Spec; #line 142 sub blib_to_par { @_ = (path => @_) if @_ == 1; my %args = @_; require Config; # don't use 'my $foo ... if ...' it creates a static variable! my $quiet = $args{quiet} || 0; my $dist; my $path = $args{path}; $dist = File::Spec->rel2abs($args{dist}) if $args{dist}; my $name = $args{name}; my $version = $args{version}; my $suffix = $args{suffix} || "$Config::Config{archname}-$Config::Config{version}.par"; my $cwd; if (defined $path) { require Cwd; $cwd = Cwd::cwd(); chdir $path; } _build_blib() unless -d "blib"; my @files; open MANIFEST, ">", File::Spec->catfile("blib", "MANIFEST") or die $!; open META, ">", File::Spec->catfile("blib", "META.yml") or die $!; require File::Find; File::Find::find( sub { next unless $File::Find::name; (-r && !-d) and push ( @files, substr($File::Find::name, 5) ); } , 'blib' ); print MANIFEST join( "\n", ' ', (sort @files), q( # ) ); close MANIFEST; if (open(OLD_META, "META.yml")) { while () { if (/^distribution_type:/) { print META "distribution_type: par\n"; } else { print META $_; } if (/^name:\s+(.*)/) { $name ||= $1; $name =~ s/::/-/g; } elsif (/^version:\s+.*Module::Build::Version/) { while () { /^\s+original:\s+(.*)/ or next; $version ||= $1; last; } } elsif (/^version:\s+(.*)/) { $version ||= $1; } } close OLD_META; close META; } if ((!$name or !$version) and open(MAKEFILE, "Makefile")) { while () { if (/^DISTNAME\s+=\s+(.*)$/) { $name ||= $1; } elsif (/^VERSION\s+=\s+(.*)$/) { $version ||= $1; } } } if (not defined($name) or not defined($version)) { # could not determine name or version. Error. my $what; if (not defined $name) { $what = 'name'; $what .= ' and version' if not defined $version; } elsif (not defined $version) { $what = 'version'; } carp("I was unable to determine the $what of the PAR distribution. Please create a Makefile or META.yml file from which we can infer the information or just specify the missing information as an option to blib_to_par."); return(); } $name =~ s/\s+$//; $version =~ s/\s+$//; my $file = "$name-$version-$suffix"; unlink $file if -f $file; print META << "YAML" if fileno(META); name: $name version: $version build_requires: {} conflicts: {} dist_name: $file distribution_type: par dynamic_config: 0 generated_by: 'PAR::Dist version $PAR::Dist::VERSION' license: unknown YAML close META; mkdir('blib', 0777); chdir('blib'); require Cwd; my $zipoutfile = File::Spec->catfile(File::Spec->updir, $file); _zip(dist => $zipoutfile); chdir(File::Spec->updir); unlink File::Spec->catfile("blib", "MANIFEST"); unlink File::Spec->catfile("blib", "META.yml"); $dist ||= File::Spec->catfile($cwd, $file) if $cwd; if ($dist and $file ne $dist) { if ( File::Copy::copy($file, $dist) ) { unlink $file; } else { die "Cannot copy $file: $!"; } $file = $dist; } my $pathname = File::Spec->rel2abs($file); if ($^O eq 'MSWin32') { $pathname =~ s!\\!/!g; $pathname =~ s!:!|!g; }; print << "." if !$quiet; Successfully created binary distribution '$file'. Its contents are accessible in compliant browsers as: jar:file://$pathname!/MANIFEST . chdir $cwd if $cwd; return $file; } sub _build_blib { if (-e 'Build') { _system_wrapper($^X, "Build"); } elsif (-e 'Makefile') { _system_wrapper($Config::Config{make}); } elsif (-e 'Build.PL') { _system_wrapper($^X, "Build.PL"); _system_wrapper($^X, "Build"); } elsif (-e 'Makefile.PL') { _system_wrapper($^X, "Makefile.PL"); _system_wrapper($Config::Config{make}); } } #line 397 sub install_par { my %args = &_args; _install_or_uninstall(%args, action => 'install'); } #line 418 sub uninstall_par { my %args = &_args; _install_or_uninstall(%args, action => 'uninstall'); } sub _install_or_uninstall { my %args = &_args; my $name = $args{name}; my $action = $args{action}; my %ENV_copy = %ENV; $ENV{PERL_INSTALL_ROOT} = $args{prefix} if defined $args{prefix}; require Cwd; my $old_dir = Cwd::cwd(); my ($dist, $tmpdir) = _unzip_to_tmpdir( dist => $args{dist}, subdir => 'blib' ); if ( open (META, File::Spec->catfile('blib', 'META.yml')) ) { while () { next unless /^name:\s+(.*)/; $name = $1; $name =~ s/\s+$//; last; } close META; } return if not defined $name or $name eq ''; if (-d 'script') { require ExtUtils::MY; foreach my $file (glob("script/*")) { next unless -T $file; ExtUtils::MY->fixin($file); chmod(0555, $file); } } $name =~ s{::|-}{/}g; require ExtUtils::Install; if ($action eq 'install') { my $target = _installation_target( File::Spec->curdir, $name, \%args ); my $custom_targets = $args{custom_targets} || {}; $target->{$_} = $custom_targets->{$_} foreach keys %{$custom_targets}; my $uninstall_shadows = $args{uninstall_shadows}; my $verbose = $args{verbose}; ExtUtils::Install::install($target, $verbose, 0, $uninstall_shadows); } elsif ($action eq 'uninstall') { require Config; my $verbose = $args{verbose}; ExtUtils::Install::uninstall( $args{packlist_read}||"$Config::Config{installsitearch}/auto/$name/.packlist", $verbose ); } %ENV = %ENV_copy; chdir($old_dir); File::Path::rmtree([$tmpdir]); return 1; } # Returns the default installation target as used by # ExtUtils::Install::install(). First parameter should be the base # directory containing the blib/ we're installing from. # Second parameter should be the name of the distribution for the packlist # paths. Third parameter may be a hash reference with user defined keys for # the target hash. In fact, any contents that do not start with 'inst_' are # skipped. sub _installation_target { require Config; my $dir = shift; my $name = shift; my $user = shift || {}; # accepted sources (and user overrides) my %sources = ( inst_lib => File::Spec->catdir($dir,"blib","lib"), inst_archlib => File::Spec->catdir($dir,"blib","arch"), inst_bin => File::Spec->catdir($dir,'blib','bin'), inst_script => File::Spec->catdir($dir,'blib','script'), inst_man1dir => File::Spec->catdir($dir,'blib','man1'), inst_man3dir => File::Spec->catdir($dir,'blib','man3'), packlist_read => 'read', packlist_write => 'write', ); my $par_has_archlib = _directory_not_empty( $sources{inst_archlib} ); # default targets my $target = { read => $Config::Config{sitearchexp}."/auto/$name/.packlist", write => $Config::Config{installsitearch}."/auto/$name/.packlist", $sources{inst_lib} => ($par_has_archlib ? $Config::Config{installsitearch} : $Config::Config{installsitelib}), $sources{inst_archlib} => $Config::Config{installsitearch}, $sources{inst_bin} => $Config::Config{installbin} , $sources{inst_script} => $Config::Config{installscript}, $sources{inst_man1dir} => $Config::Config{installman1dir}, $sources{inst_man3dir} => $Config::Config{installman3dir}, }; # Included for future support for ${flavour}perl external lib installation # if ($Config::Config{flavour_perl}) { # my $ext = File::Spec->catdir($dir, 'blib', 'ext'); # # from => to # $sources{inst_external_lib} = File::Spec->catdir($ext, 'lib'); # $sources{inst_external_bin} = File::Spec->catdir($ext, 'bin'); # $sources{inst_external_include} = File::Spec->catdir($ext, 'include'); # $sources{inst_external_src} = File::Spec->catdir($ext, 'src'); # $target->{ $sources{inst_external_lib} } = $Config::Config{flavour_install_lib}; # $target->{ $sources{inst_external_bin} } = $Config::Config{flavour_install_bin}; # $target->{ $sources{inst_external_include} } = $Config::Config{flavour_install_include}; # $target->{ $sources{inst_external_src} } = $Config::Config{flavour_install_src}; # } # insert user overrides foreach my $key (keys %$user) { my $value = $user->{$key}; if (not defined $value and $key ne 'packlist_read' and $key ne 'packlist_write') { # undef means "remove" delete $target->{ $sources{$key} }; } elsif (exists $sources{$key}) { # overwrite stuff, don't let the user create new entries $target->{ $sources{$key} } = $value; } } # apply the automatic inst_lib => inst_archlib conversion again # if the user asks for it and there is an archlib in the .par if ($user->{auto_inst_lib_conversion} and $par_has_archlib) { $target->{inst_lib} = $target->{inst_archlib}; } return $target; } sub _directory_not_empty { require File::Find; my($dir) = @_; my $files = 0; File::Find::find(sub { return if $_ eq ".exists"; if (-f) { $File::Find::prune++; $files = 1; } }, $dir); return $files; } #line 585 sub sign_par { my %args = &_args; _verify_or_sign(%args, action => 'sign'); } #line 600 sub verify_par { my %args = &_args; $! = _verify_or_sign(%args, action => 'verify'); return ( $! == Module::Signature::SIGNATURE_OK() ); } #line 629 sub merge_par { my $base_par = shift; my @additional_pars = @_; require Cwd; require File::Copy; require File::Path; require File::Find; # parameter checking if (not defined $base_par) { croak "First argument to merge_par() must be the .par archive to modify."; } if (not -f $base_par or not -r _ or not -w _) { croak "'$base_par' is not a file or you do not have enough permissions to read and modify it."; } foreach (@additional_pars) { if (not -f $_ or not -r _) { croak "'$_' is not a file or you do not have enough permissions to read it."; } } # The unzipping will change directories. Remember old dir. my $old_cwd = Cwd::cwd(); # Unzip the base par to a temp. dir. (undef, my $base_dir) = _unzip_to_tmpdir( dist => $base_par, subdir => 'blib' ); my $blibdir = File::Spec->catdir($base_dir, 'blib'); # move the META.yml to the (main) temp. dir. my $main_meta_file = File::Spec->catfile($base_dir, 'META.yml'); File::Copy::move( File::Spec->catfile($blibdir, 'META.yml'), $main_meta_file ); # delete (incorrect) MANIFEST unlink File::Spec->catfile($blibdir, 'MANIFEST'); # extract additional pars and merge foreach my $par (@additional_pars) { # restore original directory because the par path # might have been relative! chdir($old_cwd); (undef, my $add_dir) = _unzip_to_tmpdir( dist => $par ); # merge the meta (at least the provides info) into the main meta.yml my $meta_file = File::Spec->catfile($add_dir, 'META.yml'); if (-f $meta_file) { _merge_meta($main_meta_file, $meta_file); } my @files; my @dirs; # I hate File::Find # And I hate writing portable code, too. File::Find::find( {wanted =>sub { my $file = $File::Find::name; push @files, $file if -f $file; push @dirs, $file if -d _; }}, $add_dir ); my ($vol, $subdir, undef) = File::Spec->splitpath( $add_dir, 1); my @dir = File::Spec->splitdir( $subdir ); # merge directory structure foreach my $dir (@dirs) { my ($v, $d, undef) = File::Spec->splitpath( $dir, 1 ); my @d = File::Spec->splitdir( $d ); shift @d foreach @dir; # remove tmp dir from path my $target = File::Spec->catdir( $blibdir, @d ); mkdir($target); } # merge files foreach my $file (@files) { my ($v, $d, $f) = File::Spec->splitpath( $file ); my @d = File::Spec->splitdir( $d ); shift @d foreach @dir; # remove tmp dir from path my $target = File::Spec->catfile( File::Spec->catdir( $blibdir, @d ), $f ); File::Copy::copy($file, $target) or die "Could not copy '$file' to '$target': $!"; } chdir($old_cwd); File::Path::rmtree([$add_dir]); } # delete (copied) MANIFEST and META.yml unlink File::Spec->catfile($blibdir, 'MANIFEST'); unlink File::Spec->catfile($blibdir, 'META.yml'); chdir($base_dir); my $resulting_par_file = Cwd::abs_path(blib_to_par(quiet => 1)); chdir($old_cwd); File::Copy::move($resulting_par_file, $base_par); File::Path::rmtree([$base_dir]); } sub _merge_meta { my $meta_orig_file = shift; my $meta_extra_file = shift; return() if not defined $meta_orig_file or not -f $meta_orig_file; return 1 if not defined $meta_extra_file or not -f $meta_extra_file; my $yaml_functions = _get_yaml_functions(); die "Cannot merge META.yml files without a YAML reader/writer" if !exists $yaml_functions->{LoadFile} or !exists $yaml_functions->{DumpFile}; my $orig_meta = $yaml_functions->{LoadFile}->($meta_orig_file); my $extra_meta = $yaml_functions->{LoadFile}->($meta_extra_file); # I seem to remember there was this incompatibility between the different # YAML implementations with regards to "document" handling: my $orig_tree = (ref($orig_meta) eq 'ARRAY' ? $orig_meta->[0] : $orig_meta); my $extra_tree = (ref($extra_meta) eq 'ARRAY' ? $extra_meta->[0] : $extra_meta); _merge_provides($orig_tree, $extra_tree); _merge_requires($orig_tree, $extra_tree); $yaml_functions->{DumpFile}->($meta_orig_file, $orig_meta); return 1; } # merge the two-level provides sections of META.yml sub _merge_provides { my $orig_hash = shift; my $extra_hash = shift; return() if not exists $extra_hash->{provides}; $orig_hash->{provides} ||= {}; my $orig_provides = $orig_hash->{provides}; my $extra_provides = $extra_hash->{provides}; # two level clone is enough wrt META spec 1.4 # overwrite the original provides since we're also overwriting the files. foreach my $module (keys %$extra_provides) { my $extra_mod_hash = $extra_provides->{$module}; my %mod_hash; $mod_hash{$_} = $extra_mod_hash->{$_} for keys %$extra_mod_hash; $orig_provides->{$module} = \%mod_hash; } } # merge the single-level requires-like sections of META.yml sub _merge_requires { my $orig_hash = shift; my $extra_hash = shift; foreach my $type (qw(requires build_requires configure_requires recommends)) { next if not exists $extra_hash->{$type}; $orig_hash->{$type} ||= {}; # one level clone is enough wrt META spec 1.4 foreach my $module (keys %{ $extra_hash->{$type} }) { # FIXME there should be a version comparison here, BUT how are we going to do that without a guaranteed version.pm? $orig_hash->{$type}{$module} = $extra_hash->{$type}{$module}; # assign version and module name } } } #line 818 sub remove_man { my %args = &_args; my $par = $args{dist}; require Cwd; require File::Copy; require File::Path; require File::Find; # parameter checking if (not defined $par) { croak "First argument to remove_man() must be the .par archive to modify."; } if (not -f $par or not -r _ or not -w _) { croak "'$par' is not a file or you do not have enough permissions to read and modify it."; } # The unzipping will change directories. Remember old dir. my $old_cwd = Cwd::cwd(); # Unzip the base par to a temp. dir. (undef, my $base_dir) = _unzip_to_tmpdir( dist => $par, subdir => 'blib' ); my $blibdir = File::Spec->catdir($base_dir, 'blib'); # move the META.yml to the (main) temp. dir. File::Copy::move( File::Spec->catfile($blibdir, 'META.yml'), File::Spec->catfile($base_dir, 'META.yml') ); # delete (incorrect) MANIFEST unlink File::Spec->catfile($blibdir, 'MANIFEST'); opendir DIRECTORY, 'blib' or die $!; my @dirs = grep { /^blib\/(?:man\d*|html)$/ } grep { -d $_ } map { File::Spec->catfile('blib', $_) } readdir DIRECTORY; close DIRECTORY; File::Path::rmtree(\@dirs); chdir($base_dir); my $resulting_par_file = Cwd::abs_path(blib_to_par()); chdir($old_cwd); File::Copy::move($resulting_par_file, $par); File::Path::rmtree([$base_dir]); } #line 884 sub get_meta { my %args = &_args; my $dist = $args{dist}; return undef if not defined $dist or not -r $dist; require Cwd; require File::Path; # The unzipping will change directories. Remember old dir. my $old_cwd = Cwd::cwd(); # Unzip the base par to a temp. dir. (undef, my $base_dir) = _unzip_to_tmpdir( dist => $dist, subdir => 'blib' ); my $blibdir = File::Spec->catdir($base_dir, 'blib'); my $meta = File::Spec->catfile($blibdir, 'META.yml'); if (not -r $meta) { return undef; } open FH, '<', $meta or die "Could not open file '$meta' for reading: $!"; local $/ = undef; my $meta_text = ; close FH; chdir($old_cwd); File::Path::rmtree([$base_dir]); return $meta_text; } sub _unzip { my %args = &_args; my $dist = $args{dist}; my $path = $args{path} || File::Spec->curdir; return unless -f $dist; # Try fast unzipping first if (eval { require Archive::Unzip::Burst; 1 }) { my $return = !Archive::Unzip::Burst::unzip($dist, $path); return if $return; # true return value == error (a la system call) } # Then slow unzipping if (eval { require Archive::Zip; 1 }) { my $zip = Archive::Zip->new; local %SIG; $SIG{__WARN__} = sub { print STDERR $_[0] unless $_[0] =~ /\bstat\b/ }; return unless $zip->read($dist) == Archive::Zip::AZ_OK() and $zip->extractTree('', "$path/") == Archive::Zip::AZ_OK(); } # Then fall back to the system else { undef $!; if (_system_wrapper(unzip => $dist, '-d', $path)) { die "Failed to unzip '$dist' to path '$path': Could neither load " . "Archive::Zip nor (successfully) run the system 'unzip' (unzip said: $!)"; } } return 1; } sub _zip { my %args = &_args; my $dist = $args{dist}; if (eval { require Archive::Zip; 1 }) { my $zip = Archive::Zip->new; $zip->addTree( File::Spec->curdir, '' ); $zip->writeToFileNamed( $dist ) == Archive::Zip::AZ_OK() or die $!; } else { undef $!; if (_system_wrapper(qw(zip -r), $dist, File::Spec->curdir)) { die "Failed to zip '" .File::Spec->curdir(). "' to '$dist': Could neither load " . "Archive::Zip nor (successfully) run the system 'zip' (zip said: $!)"; } } return 1; } # This sub munges the arguments to most of the PAR::Dist functions # into a hash. On the way, it downloads PAR archives as necessary, etc. sub _args { # default to the first .par in the CWD if (not @_) { @_ = (glob('*.par'))[0]; } # single argument => it's a distribution file name or URL @_ = (dist => @_) if @_ == 1; my %args = @_; $args{name} ||= $args{dist}; # If we are installing from an URL, we want to munge the # distribution name so that it is in form "Module-Name" if (defined $args{name}) { $args{name} =~ s/^\w+:\/\///; my @elems = parse_dist_name($args{name}); # @elems is name, version, arch, perlversion if (defined $elems[0]) { $args{name} = $elems[0]; } else { $args{name} =~ s/^.*\/([^\/]+)$/$1/; $args{name} =~ s/^([0-9A-Za-z_-]+)-\d+\..+$/$1/; } } # append suffix if there is none if ($args{dist} and not $args{dist} =~ /\.[a-zA-Z_][^.]*$/) { require Config; my $suffix = $args{suffix}; $suffix ||= "$Config::Config{archname}-$Config::Config{version}.par"; $args{dist} .= "-$suffix"; } # download if it's an URL if ($args{dist} and $args{dist} =~ m!^\w+://!) { $args{dist} = _fetch(dist => $args{dist}) } return %args; } # Download PAR archive, but only if necessary (mirror!) my %escapes; sub _fetch { my %args = @_; if ($args{dist} =~ s/^file:\/\///) { return $args{dist} if -e $args{dist}; return; } require LWP::Simple; $ENV{PAR_TEMP} ||= File::Spec->catdir(File::Spec->tmpdir, 'par'); mkdir $ENV{PAR_TEMP}, 0777; %escapes = map { chr($_) => sprintf("%%%02X", $_) } 0..255 unless %escapes; $args{dist} =~ s{^cpan://((([a-zA-Z])[a-zA-Z])[-_a-zA-Z]+)/} {http://www.cpan.org/modules/by-authors/id/\U$3/$2/$1\E/}; my $file = $args{dist}; $file =~ s/([^\w\.])/$escapes{$1}/g; $file = File::Spec->catfile( $ENV{PAR_TEMP}, $file); my $rc = LWP::Simple::mirror( $args{dist}, $file ); if (!LWP::Simple::is_success($rc) and $rc != 304) { die "Error $rc: ", LWP::Simple::status_message($rc), " ($args{dist})\n"; } return $file if -e $file; return; } sub _verify_or_sign { my %args = &_args; require File::Path; require Module::Signature; die "Module::Signature version 0.25 required" unless Module::Signature->VERSION >= 0.25; require Cwd; my $cwd = Cwd::cwd(); my $action = $args{action}; my ($dist, $tmpdir) = _unzip_to_tmpdir($args{dist}); $action ||= (-e 'SIGNATURE' ? 'verify' : 'sign'); if ($action eq 'sign') { open FH, '>SIGNATURE' unless -e 'SIGNATURE'; open FH, 'MANIFEST' or die $!; local $/; my $out = ; if ($out !~ /^SIGNATURE(?:\s|$)/m) { $out =~ s/^(?!\s)/SIGNATURE\n/m; open FH, '>MANIFEST' or die $!; print FH $out; } close FH; $args{overwrite} = 1 unless exists $args{overwrite}; $args{skip} = 0 unless exists $args{skip}; } my $rv = Module::Signature->can($action)->(%args); _zip(dist => $dist) if $action eq 'sign'; File::Path::rmtree([$tmpdir]); chdir($cwd); return $rv; } sub _unzip_to_tmpdir { my %args = &_args; require File::Temp; my $dist = File::Spec->rel2abs($args{dist}); my $tmpdirname = File::Spec->catdir(File::Spec->tmpdir, "parXXXXX"); my $tmpdir = File::Temp::mkdtemp($tmpdirname) or die "Could not create temporary directory from template '$tmpdirname': $!"; my $path = $tmpdir; $path = File::Spec->catdir($tmpdir, $args{subdir}) if defined $args{subdir}; _unzip(dist => $dist, path => $path); chdir $tmpdir; return ($dist, $tmpdir); } #line 1132 sub parse_dist_name { my $file = shift; return(undef, undef, undef, undef) if not defined $file; (undef, undef, $file) = File::Spec->splitpath($file); my $version = qr/v?(?:\d+(?:_\d+)?|\d*(?:\.\d+(?:_\d+)?)+)/; $file =~ s/\.(?:par|tar\.gz|tar)$//i; my @elem = split /-/, $file; my (@dn, $dv, @arch, $pv); while (@elem) { my $e = shift @elem; if ( $e =~ /^$version$/o and not(# if not next token also a version # (assumes an arch string doesnt start with a version...) @elem and $elem[0] =~ /^$version$/o ) ) { $dv = $e; last; } push @dn, $e; } my $dn; $dn = join('-', @dn) if @dn; if (not @elem) { return( $dn, $dv, undef, undef); } while (@elem) { my $e = shift @elem; if ($e =~ /^$version|any_version$/) { $pv = $e; last; } push @arch, $e; } my $arch; $arch = join('-', @arch) if @arch; return($dn, $dv, $arch, $pv); } #line 1209 sub generate_blib_stub { my %args = &_args; my $dist = $args{dist}; require Config; my $name = $args{name}; my $version = $args{version}; my $suffix = $args{suffix}; my ($parse_name, $parse_version, $archname, $perlversion) = parse_dist_name($dist); $name ||= $parse_name; $version ||= $parse_version; $suffix = "$archname-$perlversion" if (not defined $suffix or $suffix eq '') and $archname and $perlversion; $suffix ||= "$Config::Config{archname}-$Config::Config{version}"; if ( grep { not defined $_ } ($name, $version, $suffix) ) { warn "Could not determine distribution meta information from distribution name '$dist'"; return(); } $suffix =~ s/\.par$//; if (not -f 'META.yml') { open META, '>', 'META.yml' or die "Could not open META.yml file for writing: $!"; print META << "YAML" if fileno(META); name: $name version: $version build_requires: {} conflicts: {} dist_name: $name-$version-$suffix.par distribution_type: par dynamic_config: 0 generated_by: 'PAR::Dist version $PAR::Dist::VERSION' license: unknown YAML close META; } mkdir('blib'); mkdir(File::Spec->catdir('blib', 'lib')); mkdir(File::Spec->catdir('blib', 'script')); return 1; } #line 1277 sub contains_binaries { require File::Find; my %args = &_args; my $dist = $args{dist}; return undef if not defined $dist or not -r $dist; require Cwd; require File::Path; # The unzipping will change directories. Remember old dir. my $old_cwd = Cwd::cwd(); # Unzip the base par to a temp. dir. (undef, my $base_dir) = _unzip_to_tmpdir( dist => $dist, subdir => 'blib' ); my $blibdir = File::Spec->catdir($base_dir, 'blib'); my $archdir = File::Spec->catdir($blibdir, 'arch'); my $found = 0; File::Find::find( sub { $found++ if -f $_ and not /^\.exists$/; }, $archdir ); chdir($old_cwd); File::Path::rmtree([$base_dir]); return $found ? 1 : 0; } sub _system_wrapper { if ($DEBUG) { Carp::cluck("Running system call '@_' from:"); } return system(@_); } # stolen from Module::Install::Can # very much internal and subject to change or removal sub _MI_can_run { require ExtUtils::MakeMaker; my ($cmd) = @_; my $_cmd = $cmd; return $_cmd if (-x $_cmd or $_cmd = MM->maybe_command($_cmd)); for my $dir ((split /$Config::Config{path_sep}/, $ENV{PATH}), '.') { my $abs = File::Spec->catfile($dir, $cmd); return $abs if (-x $abs or $abs = MM->maybe_command($abs)); } return; } # Tries to load any YAML reader writer I know of # returns nothing on failure or hash reference containing # a subset of Load, Dump, LoadFile, DumpFile # entries with sub references on success. sub _get_yaml_functions { # reasoning for the ranking here: # - syck is fast and reasonably complete # - YAML.pm is slow and aging # - Tiny is only a very small subset # - XS is very new and I'm not sure it's ready for prime-time yet # - Parse... is only a reader and only deals with the same subset as ::Tiny my @modules = qw(YAML::Syck YAML YAML::Tiny YAML::XS Parse::CPAN::Meta); my %yaml_functions; foreach my $module (@modules) { eval "require $module;"; if (!$@) { warn "PAR::Dist testers/debug info: Using '$module' as YAML implementation" if $DEBUG; foreach my $sub (qw(Load Dump LoadFile DumpFile)) { no strict 'refs'; my $subref = *{"${module}::$sub"}{CODE}; if (defined $subref and ref($subref) eq 'CODE') { $yaml_functions{$sub} = $subref; } } $yaml_functions{yaml_provider} = $module; last; } } # end foreach module candidates if (not keys %yaml_functions) { warn "Cannot find a working YAML reader/writer implementation. Tried to load all of '@modules'"; } return(\%yaml_functions); } sub _check_tools { my $tools = _get_yaml_functions(); if ($DEBUG) { foreach (qw/Load Dump LoadFile DumpFile/) { warn "No YAML support for $_ found.\n" if not defined $tools->{$_}; } } $tools->{zip} = undef; # A::Zip 1.28 was a broken release... if (eval {require Archive::Zip; 1;} and $Archive::Zip::VERSION ne '1.28') { warn "Using Archive::Zip as ZIP tool.\n" if $DEBUG; $tools->{zip} = 'Archive::Zip'; } elsif (_MI_can_run("zip") and _MI_can_run("unzip")) { warn "Using zip/unzip as ZIP tool.\n" if $DEBUG; $tools->{zip} = 'zip'; } else { warn "Found neither Archive::Zip (version != 1.28) nor ZIP/UNZIP as valid ZIP tools.\n" if $DEBUG; $tools->{zip} = undef; } return $tools; } 1; #line 1426 FILE65c9221a/PAR/Filter.pm{#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/Filter.pm" package PAR::Filter; use 5.006; use strict; use warnings; our $VERSION = '0.03'; #line 64 sub new { my $class = shift; require "PAR/Filter/$_.pm" foreach @_; bless(\@_, $class); } sub apply { my ($self, $ref, $name) = @_; my $filename = $name || '-e'; if (!ref $ref) { $name ||= $filename = $ref; local $/; open my $fh, $ref or die $!; binmode($fh); my $content = <$fh>; $ref = \$content; return $ref unless length($content); } "PAR::Filter::$_"->new->apply( $ref, $filename, $name ) foreach @$self; return $ref; } 1; #line 106 FILEb19192a7/PAR/Filter/PodStrip.pm#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/Filter/PodStrip.pm" package PAR::Filter::PodStrip; use 5.006; use strict; use warnings; use base 'PAR::Filter'; #line 22 sub apply { my ($class, $ref, $filename, $name) = @_; no warnings 'uninitialized'; my $data = ''; $data = $1 if $$ref =~ s/((?:^__DATA__\r?\n).*)//ms; my $line = 1; if ($$ref =~ /^=(?:head\d|pod|begin|item|over|for|back|end|cut)\b/) { $$ref = "\n$$ref"; $line--; } $$ref =~ s{( (.*?\n) (?:=(?:head\d|pod|begin|item|over|for|back|end)\b .*?\n) (?:=cut[\t ]*[\r\n]*?|\Z) (\r?\n)? )}{ my ($pre, $post) = ($2, $3); "$pre#line " . ( $line += ( () = ( $1 =~ /\n/g ) ) ) . $post; }gsex; $$ref =~ s{^=encoding\s+\S+\s*$}{\n}mg; $$ref = '#line 1 "' . ($filename) . "\"\n" . $$ref if length $filename; $$ref =~ s/^#line 1 (.*\n)(#!.*\n)/$2#line 2 $1/g; $$ref .= $data; } 1; #line 85 FILE9de386d4/PAR/Heavy.pm#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/Heavy.pm" package PAR::Heavy; $PAR::Heavy::VERSION = '0.12'; #line 17 ######################################################################## # Dynamic inclusion of XS modules my ($bootstrap, $dl_findfile); # Caches for code references my ($dlext); # Cache for $Config{dlext} my ($cache_key); # The current file to find my $is_insensitive_fs = ( -s $0 and (-s lc($0) || -1) == (-s uc($0) || -1) and (-s lc($0) || -1) == -s $0 ); # Adds pre-hooks to Dynaloader's key methods sub _init_dynaloader { return if $bootstrap; return unless eval { require DynaLoader; DynaLoader::dl_findfile(); 1 }; $bootstrap = \&DynaLoader::bootstrap; $dl_findfile = \&DynaLoader::dl_findfile; local $^W; *{'DynaLoader::dl_expandspec'} = sub { return }; *{'DynaLoader::bootstrap'} = \&_bootstrap; *{'DynaLoader::dl_findfile'} = \&_dl_findfile; } # Return the cached location of .dll inside PAR first, if possible. sub _dl_findfile { return $FullCache{$cache_key} if exists $FullCache{$cache_key}; if ($is_insensitive_fs) { # We have a case-insensitive filesystem... my ($key) = grep { lc($_) eq lc($cache_key) } keys %FullCache; return $FullCache{$key} if defined $key; } return $dl_findfile->(@_); } # Find and extract .dll from PAR files for a given dynamic module. sub _bootstrap { my (@args) = @_; my ($module) = $args[0] or return; my @modparts = split(/::/, $module); my $modfname = $modparts[-1]; $modfname = &DynaLoader::mod2fname(\@modparts) if defined &DynaLoader::mod2fname; if (($^O eq 'NetWare') && (length($modfname) > 8)) { $modfname = substr($modfname, 0, 8); } # XXX: Multi-platform .dll support in PARs needs better than $Config. # FIXME: Config is always loaded by PAR.pm! $dlext ||= do { require Config; (%Config::Config) ? $Config::Config{dlext} : ''; }; my $modpname = join((($^O eq 'MacOS') ? ':' : '/'), @modparts); my $file = $cache_key = "auto/$modpname/$modfname.$dlext"; if ($FullCache{$file}) { # TODO: understand local $DynaLoader::do_expand = 1; return $bootstrap->(@args); } my $member; # First, try to find things in the peferentially loaded PARs: $member = PAR::_find_par_internals([@PAR::PAR_INC], undef, $file, 1) if defined &PAR::_find_par_internals; # If that failed to find the dll, let DynaLoader (try or) throw an error unless ($member) { my $filename = eval { $bootstrap->(@args) }; return $filename if not $@ and defined $filename; # Now try the fallback pars $member = PAR::_find_par_internals([@PAR::PAR_INC_LAST], undef, $file, 1) if defined &PAR::_find_par_internals; # If that fails, let dynaloader have another go JUST to throw an error # While this may seem wasteful, nothing really matters once we fail to # load shared libraries! unless ($member) { return $bootstrap->(@args); } } $FullCache{$file} = _dl_extract($member, $file); # Now extract all associated shared objs in the same auto/ dir # XXX: shouldn't this also set $FullCache{...} for those files? my $first = $member->fileName; my $path_pattern = $first; $path_pattern =~ s{[^/]*$}{}; if ($PAR::LastAccessedPAR) { foreach my $member ( $PAR::LastAccessedPAR->members ) { next if $member->isDirectory; my $name = $member->fileName; next if $name eq $first; next unless $name =~ m{^/?\Q$path_pattern\E\/[^/]*\.\Q$dlext\E[^/]*$}; $name =~ s{.*/}{}; _dl_extract($member, $file, $name); } } local $DynaLoader::do_expand = 1; return $bootstrap->(@args); } sub _dl_extract { my ($member, $file, $name) = @_; require File::Spec; require File::Temp; my ($fh, $filename); # fix borked tempdir from earlier versions if ($ENV{PAR_TEMP} and -e $ENV{PAR_TEMP} and !-d $ENV{PAR_TEMP}) { unlink($ENV{PAR_TEMP}); mkdir($ENV{PAR_TEMP}, 0755); } if ($ENV{PAR_CLEAN} and !$name) { ($fh, $filename) = File::Temp::tempfile( DIR => ($ENV{PAR_TEMP} || File::Spec->tmpdir), SUFFIX => ".$dlext", UNLINK => ($^O ne 'MSWin32' and $^O !~ /hpux/), ); ($filename) = $filename =~ /^([\x20-\xff]+)$/; } else { $filename = File::Spec->catfile( ($ENV{PAR_TEMP} || File::Spec->tmpdir), ($name || ($member->crc32String . ".$dlext")) ); ($filename) = $filename =~ /^([\x20-\xff]+)$/; open $fh, '>', $filename or die $! unless -r $filename and -e _ and -s _ == $member->uncompressedSize; } if ($fh) { binmode($fh); $member->extractToFileHandle($fh); close $fh; chmod 0755, $filename; } return $filename; } 1; #line 205 FILEd4ce3f54/PAR/SetupProgname.pm#line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/SetupProgname.pm" package PAR::SetupProgname; $PAR::SetupProgname::VERSION = '1.002'; use 5.006; use strict; use warnings; use Config (); #line 26 # for PAR internal use only! our $Progname = $ENV{PAR_PROGNAME} || $0; # same code lives in PAR::Packer's par.pl! sub set_progname { require File::Spec; if (defined $ENV{PAR_PROGNAME} and $ENV{PAR_PROGNAME} =~ /(.+)/) { $Progname = $1; } $Progname = $0 if not defined $Progname; if (( () = File::Spec->splitdir($Progname) ) > 1 or !$ENV{PAR_PROGNAME}) { if (open my $fh, $Progname) { return if -s $fh; } if (-s "$Progname$Config::Config{_exe}") { $Progname .= $Config::Config{_exe}; return; } } foreach my $dir (split /\Q$Config::Config{path_sep}\E/, $ENV{PATH}) { next if exists $ENV{PAR_TEMP} and $dir eq $ENV{PAR_TEMP}; my $name = File::Spec->catfile($dir, "$Progname$Config::Config{_exe}"); if (-s $name) { $Progname = $name; last } $name = File::Spec->catfile($dir, "$Progname"); if (-s $name) { $Progname = $name; last } } } 1; __END__ #line 94 FILE5ff06337/PAR/SetupTemp.pm #line 1 "/usr/lib/perl5/site_perl/5.12.2/PAR/SetupTemp.pm" package PAR::SetupTemp; $PAR::SetupTemp::VERSION = '1.002'; use 5.006; use strict; use warnings; use PAR::SetupProgname; #line 29 # for PAR internal use only! our $PARTemp; # The C version of this code appears in myldr/mktmpdir.c # This code also lives in PAR::Packer's par.pl as _set_par_temp! sub set_par_temp_env { PAR::SetupProgname::set_progname() unless defined $PAR::SetupProgname::Progname; if (defined $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/) { $PARTemp = $1; return; } my $stmpdir = _get_par_user_tempdir(); require File::Spec; if (defined $stmpdir) { # it'd be quite bad if this was not the case if (!$ENV{PAR_CLEAN} and my $mtime = (stat($PAR::SetupProgname::Progname))[9]) { my $ctx = _get_digester(); # Workaround for bug in Digest::SHA 5.38 and 5.39 my $sha_version = eval { $Digest::SHA::VERSION } || 0; if ($sha_version eq '5.38' or $sha_version eq '5.39') { $ctx->addfile($PAR::SetupProgname::Progname, "b") if ($ctx); } else { if ($ctx and open(my $fh, "<$PAR::SetupProgname::Progname")) { binmode($fh); $ctx->addfile($fh); close($fh); } } $stmpdir = File::Spec->catdir( $stmpdir, "cache-" . ( $ctx ? $ctx->hexdigest : $mtime ) ); } else { $ENV{PAR_CLEAN} = 1; $stmpdir = File::Spec->catdir($stmpdir, "temp-$$"); } $ENV{PAR_TEMP} = $stmpdir; mkdir $stmpdir, 0755; } # end if found a temp dir $PARTemp = $1 if defined $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/; } # Find any digester # Used in PAR::Repository::Client! sub _get_digester { my $ctx = eval { require Digest::SHA; Digest::SHA->new(1) } || eval { require Digest::SHA1; Digest::SHA1->new } || eval { require Digest::MD5; Digest::MD5->new }; return $ctx; } # find the per-user temporary directory (eg /tmp/par-$USER) # Used in PAR::Repository::Client! sub _get_par_user_tempdir { my $username = _find_username(); my $temp_path; foreach my $path ( (map $ENV{$_}, qw( PAR_TMPDIR TMPDIR TEMPDIR TEMP TMP )), qw( C:\\TEMP /tmp . ) ) { next unless defined $path and -d $path and -w $path; $temp_path = File::Spec->catdir($path, "par-$username"); ($temp_path) = $temp_path =~ /^(.*)$/s; mkdir $temp_path, 0755; last; } return $temp_path; } # tries hard to find out the name of the current user sub _find_username { my $username; my $pwuid; # does not work everywhere: eval {($pwuid) = getpwuid($>) if defined $>;}; if ( defined(&Win32::LoginName) ) { $username = &Win32::LoginName; } elsif (defined $pwuid) { $username = $pwuid; } else { $username = $ENV{USERNAME} || $ENV{USER} || 'SYSTEM'; } $username =~ s/\W/_/g; return $username; } 1; __END__ #line 164 FILE458a4489/Archive/Zip.pmC/#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip.pm" package Archive::Zip; use strict; BEGIN { require 5.003_96; } use UNIVERSAL (); use Carp (); use Cwd (); use IO::File (); use IO::Seekable (); use Compress::Raw::Zlib (); use File::Spec (); use File::Temp (); use FileHandle (); use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; require Exporter; @ISA = qw( Exporter ); } use vars qw( $ChunkSize $ErrorHandler ); BEGIN { # This is the size we'll try to read, write, and (de)compress. # You could set it to something different if you had lots of memory # and needed more speed. $ChunkSize ||= 32768; $ErrorHandler = \&Carp::carp; } # BEGIN block is necessary here so that other modules can use the constants. use vars qw( @EXPORT_OK %EXPORT_TAGS ); BEGIN { @EXPORT_OK = ('computeCRC32'); %EXPORT_TAGS = ( CONSTANTS => [ qw( FA_MSDOS FA_UNIX GPBF_ENCRYPTED_MASK GPBF_DEFLATING_COMPRESSION_MASK GPBF_HAS_DATA_DESCRIPTOR_MASK COMPRESSION_STORED COMPRESSION_DEFLATED COMPRESSION_LEVEL_NONE COMPRESSION_LEVEL_DEFAULT COMPRESSION_LEVEL_FASTEST COMPRESSION_LEVEL_BEST_COMPRESSION IFA_TEXT_FILE_MASK IFA_TEXT_FILE IFA_BINARY_FILE ) ], MISC_CONSTANTS => [ qw( FA_AMIGA FA_VAX_VMS FA_VM_CMS FA_ATARI_ST FA_OS2_HPFS FA_MACINTOSH FA_Z_SYSTEM FA_CPM FA_TOPS20 FA_WINDOWS_NTFS FA_QDOS FA_ACORN FA_VFAT FA_MVS FA_BEOS FA_TANDEM FA_THEOS GPBF_IMPLODING_8K_SLIDING_DICTIONARY_MASK GPBF_IMPLODING_3_SHANNON_FANO_TREES_MASK GPBF_IS_COMPRESSED_PATCHED_DATA_MASK COMPRESSION_SHRUNK DEFLATING_COMPRESSION_NORMAL DEFLATING_COMPRESSION_MAXIMUM DEFLATING_COMPRESSION_FAST DEFLATING_COMPRESSION_SUPER_FAST COMPRESSION_REDUCED_1 COMPRESSION_REDUCED_2 COMPRESSION_REDUCED_3 COMPRESSION_REDUCED_4 COMPRESSION_IMPLODED COMPRESSION_TOKENIZED COMPRESSION_DEFLATED_ENHANCED COMPRESSION_PKWARE_DATA_COMPRESSION_LIBRARY_IMPLODED ) ], ERROR_CODES => [ qw( AZ_OK AZ_STREAM_END AZ_ERROR AZ_FORMAT_ERROR AZ_IO_ERROR ) ], # For Internal Use Only PKZIP_CONSTANTS => [ qw( SIGNATURE_FORMAT SIGNATURE_LENGTH LOCAL_FILE_HEADER_SIGNATURE LOCAL_FILE_HEADER_FORMAT LOCAL_FILE_HEADER_LENGTH CENTRAL_DIRECTORY_FILE_HEADER_SIGNATURE DATA_DESCRIPTOR_FORMAT DATA_DESCRIPTOR_LENGTH DATA_DESCRIPTOR_SIGNATURE DATA_DESCRIPTOR_FORMAT_NO_SIG DATA_DESCRIPTOR_LENGTH_NO_SIG CENTRAL_DIRECTORY_FILE_HEADER_FORMAT CENTRAL_DIRECTORY_FILE_HEADER_LENGTH END_OF_CENTRAL_DIRECTORY_SIGNATURE END_OF_CENTRAL_DIRECTORY_SIGNATURE_STRING END_OF_CENTRAL_DIRECTORY_FORMAT END_OF_CENTRAL_DIRECTORY_LENGTH ) ], # For Internal Use Only UTILITY_METHODS => [ qw( _error _printError _ioError _formatError _subclassResponsibility _binmode _isSeekable _newFileHandle _readSignature _asZipDirName ) ], ); # Add all the constant names and error code names to @EXPORT_OK Exporter::export_ok_tags( qw( CONSTANTS ERROR_CODES PKZIP_CONSTANTS UTILITY_METHODS MISC_CONSTANTS ) ); } # Error codes use constant AZ_OK => 0; use constant AZ_STREAM_END => 1; use constant AZ_ERROR => 2; use constant AZ_FORMAT_ERROR => 3; use constant AZ_IO_ERROR => 4; # File types # Values of Archive::Zip::Member->fileAttributeFormat() use constant FA_MSDOS => 0; use constant FA_AMIGA => 1; use constant FA_VAX_VMS => 2; use constant FA_UNIX => 3; use constant FA_VM_CMS => 4; use constant FA_ATARI_ST => 5; use constant FA_OS2_HPFS => 6; use constant FA_MACINTOSH => 7; use constant FA_Z_SYSTEM => 8; use constant FA_CPM => 9; use constant FA_TOPS20 => 10; use constant FA_WINDOWS_NTFS => 11; use constant FA_QDOS => 12; use constant FA_ACORN => 13; use constant FA_VFAT => 14; use constant FA_MVS => 15; use constant FA_BEOS => 16; use constant FA_TANDEM => 17; use constant FA_THEOS => 18; # general-purpose bit flag masks # Found in Archive::Zip::Member->bitFlag() use constant GPBF_ENCRYPTED_MASK => 1 << 0; use constant GPBF_DEFLATING_COMPRESSION_MASK => 3 << 1; use constant GPBF_HAS_DATA_DESCRIPTOR_MASK => 1 << 3; # deflating compression types, if compressionMethod == COMPRESSION_DEFLATED # ( Archive::Zip::Member->bitFlag() & GPBF_DEFLATING_COMPRESSION_MASK ) use constant DEFLATING_COMPRESSION_NORMAL => 0 << 1; use constant DEFLATING_COMPRESSION_MAXIMUM => 1 << 1; use constant DEFLATING_COMPRESSION_FAST => 2 << 1; use constant DEFLATING_COMPRESSION_SUPER_FAST => 3 << 1; # compression method # these two are the only ones supported in this module use constant COMPRESSION_STORED => 0; # file is stored (no compression) use constant COMPRESSION_DEFLATED => 8; # file is Deflated use constant COMPRESSION_LEVEL_NONE => 0; use constant COMPRESSION_LEVEL_DEFAULT => -1; use constant COMPRESSION_LEVEL_FASTEST => 1; use constant COMPRESSION_LEVEL_BEST_COMPRESSION => 9; # internal file attribute bits # Found in Archive::Zip::Member::internalFileAttributes() use constant IFA_TEXT_FILE_MASK => 1; use constant IFA_TEXT_FILE => 1; use constant IFA_BINARY_FILE => 0; # PKZIP file format miscellaneous constants (for internal use only) use constant SIGNATURE_FORMAT => "V"; use constant SIGNATURE_LENGTH => 4; # these lengths are without the signature. use constant LOCAL_FILE_HEADER_SIGNATURE => 0x04034b50; use constant LOCAL_FILE_HEADER_FORMAT => "v3 V4 v2"; use constant LOCAL_FILE_HEADER_LENGTH => 26; # PKZIP docs don't mention the signature, but Info-Zip writes it. use constant DATA_DESCRIPTOR_SIGNATURE => 0x08074b50; use constant DATA_DESCRIPTOR_FORMAT => "V3"; use constant DATA_DESCRIPTOR_LENGTH => 12; # but the signature is apparently optional. use constant DATA_DESCRIPTOR_FORMAT_NO_SIG => "V2"; use constant DATA_DESCRIPTOR_LENGTH_NO_SIG => 8; use constant CENTRAL_DIRECTORY_FILE_HEADER_SIGNATURE => 0x02014b50; use constant CENTRAL_DIRECTORY_FILE_HEADER_FORMAT => "C2 v3 V4 v5 V2"; use constant CENTRAL_DIRECTORY_FILE_HEADER_LENGTH => 42; use constant END_OF_CENTRAL_DIRECTORY_SIGNATURE => 0x06054b50; use constant END_OF_CENTRAL_DIRECTORY_SIGNATURE_STRING => pack( "V", END_OF_CENTRAL_DIRECTORY_SIGNATURE ); use constant END_OF_CENTRAL_DIRECTORY_FORMAT => "v4 V2 v"; use constant END_OF_CENTRAL_DIRECTORY_LENGTH => 18; use constant GPBF_IMPLODING_8K_SLIDING_DICTIONARY_MASK => 1 << 1; use constant GPBF_IMPLODING_3_SHANNON_FANO_TREES_MASK => 1 << 2; use constant GPBF_IS_COMPRESSED_PATCHED_DATA_MASK => 1 << 5; # the rest of these are not supported in this module use constant COMPRESSION_SHRUNK => 1; # file is Shrunk use constant COMPRESSION_REDUCED_1 => 2; # file is Reduced CF=1 use constant COMPRESSION_REDUCED_2 => 3; # file is Reduced CF=2 use constant COMPRESSION_REDUCED_3 => 4; # file is Reduced CF=3 use constant COMPRESSION_REDUCED_4 => 5; # file is Reduced CF=4 use constant COMPRESSION_IMPLODED => 6; # file is Imploded use constant COMPRESSION_TOKENIZED => 7; # reserved for Tokenizing compr. use constant COMPRESSION_DEFLATED_ENHANCED => 9; # reserved for enh. Deflating use constant COMPRESSION_PKWARE_DATA_COMPRESSION_LIBRARY_IMPLODED => 10; # Load the various required classes require Archive::Zip::Archive; require Archive::Zip::Member; require Archive::Zip::FileMember; require Archive::Zip::DirectoryMember; require Archive::Zip::ZipFileMember; require Archive::Zip::NewFileMember; require Archive::Zip::StringMember; use constant ZIPARCHIVECLASS => 'Archive::Zip::Archive'; use constant ZIPMEMBERCLASS => 'Archive::Zip::Member'; # Convenience functions sub _ISA ($$) { # Can't rely on Scalar::Util, so use the next best way local $@; !! eval { ref $_[0] and $_[0]->isa($_[1]) }; } sub _CAN ($$) { local $@; !! eval { ref $_[0] and $_[0]->can($_[1]) }; } ##################################################################### # Methods sub new { my $class = shift; return $class->ZIPARCHIVECLASS->new(@_); } sub computeCRC32 { my ( $data, $crc ); if ( ref( $_[0] ) eq 'HASH' ) { $data = $_[0]->{string}; $crc = $_[0]->{checksum}; } else { $data = shift; $data = shift if ref($data); $crc = shift; } return Compress::Raw::Zlib::crc32( $data, $crc ); } # Report or change chunk size used for reading and writing. # Also sets Zlib's default buffer size (eventually). sub setChunkSize { shift if ref( $_[0] ) eq 'Archive::Zip::Archive'; my $chunkSize = ( ref( $_[0] ) eq 'HASH' ) ? shift->{chunkSize} : shift; my $oldChunkSize = $Archive::Zip::ChunkSize; $Archive::Zip::ChunkSize = $chunkSize if ($chunkSize); return $oldChunkSize; } sub chunkSize { return $Archive::Zip::ChunkSize; } sub setErrorHandler { my $errorHandler = ( ref( $_[0] ) eq 'HASH' ) ? shift->{subroutine} : shift; $errorHandler = \&Carp::carp unless defined($errorHandler); my $oldErrorHandler = $Archive::Zip::ErrorHandler; $Archive::Zip::ErrorHandler = $errorHandler; return $oldErrorHandler; } ###################################################################### # Private utility functions (not methods). sub _printError { my $string = join ( ' ', @_, "\n" ); my $oldCarpLevel = $Carp::CarpLevel; $Carp::CarpLevel += 2; &{$ErrorHandler} ($string); $Carp::CarpLevel = $oldCarpLevel; } # This is called on format errors. sub _formatError { shift if ref( $_[0] ); _printError( 'format error:', @_ ); return AZ_FORMAT_ERROR; } # This is called on IO errors. sub _ioError { shift if ref( $_[0] ); _printError( 'IO error:', @_, ':', $! ); return AZ_IO_ERROR; } # This is called on generic errors. sub _error { shift if ref( $_[0] ); _printError( 'error:', @_ ); return AZ_ERROR; } # Called when a subclass should have implemented # something but didn't sub _subclassResponsibility { Carp::croak("subclass Responsibility\n"); } # Try to set the given file handle or object into binary mode. sub _binmode { my $fh = shift; return _CAN( $fh, 'binmode' ) ? $fh->binmode() : binmode($fh); } # Attempt to guess whether file handle is seekable. # Because of problems with Windows, this only returns true when # the file handle is a real file. sub _isSeekable { my $fh = shift; return 0 unless ref $fh; if ( _ISA($fh, 'IO::Scalar') ) { # IO::Scalar objects are brokenly-seekable return 0; } if ( _ISA($fh, 'IO::String') ) { return 1; } if ( _ISA($fh, 'IO::Seekable') ) { # Unfortunately, some things like FileHandle objects # return true for Seekable, but AREN'T!!!!! if ( _ISA($fh, 'FileHandle') ) { return 0; } else { return 1; } } if ( _CAN($fh, 'stat') ) { return -f $fh; } return ( _CAN($fh, 'seek') and _CAN($fh, 'tell') ) ? 1 : 0; } # Print to the filehandle, while making sure the pesky Perl special global # variables don't interfere. sub _print { my ($self, $fh, @data) = @_; local $\; return $fh->print(@data); } # Return an opened IO::Handle # my ( $status, fh ) = _newFileHandle( 'fileName', 'w' ); # Can take a filename, file handle, or ref to GLOB # Or, if given something that is a ref but not an IO::Handle, # passes back the same thing. sub _newFileHandle { my $fd = shift; my $status = 1; my $handle; if ( ref($fd) ) { if ( _ISA($fd, 'IO::Scalar') or _ISA($fd, 'IO::String') ) { $handle = $fd; } elsif ( _ISA($fd, 'IO::Handle') or ref($fd) eq 'GLOB' ) { $handle = IO::File->new; $status = $handle->fdopen( $fd, @_ ); } else { $handle = $fd; } } else { $handle = IO::File->new; $status = $handle->open( $fd, @_ ); } return ( $status, $handle ); } # Returns next signature from given file handle, leaves # file handle positioned afterwards. # In list context, returns ($status, $signature) # ( $status, $signature) = _readSignature( $fh, $fileName ); sub _readSignature { my $fh = shift; my $fileName = shift; my $expectedSignature = shift; # optional my $signatureData; my $bytesRead = $fh->read( $signatureData, SIGNATURE_LENGTH ); if ( $bytesRead != SIGNATURE_LENGTH ) { return _ioError("reading header signature"); } my $signature = unpack( SIGNATURE_FORMAT, $signatureData ); my $status = AZ_OK; # compare with expected signature, if any, or any known signature. if ( ( defined($expectedSignature) && $signature != $expectedSignature ) || ( !defined($expectedSignature) && $signature != CENTRAL_DIRECTORY_FILE_HEADER_SIGNATURE && $signature != LOCAL_FILE_HEADER_SIGNATURE && $signature != END_OF_CENTRAL_DIRECTORY_SIGNATURE && $signature != DATA_DESCRIPTOR_SIGNATURE ) ) { my $errmsg = sprintf( "bad signature: 0x%08x", $signature ); if ( _isSeekable($fh) ) { $errmsg .= sprintf( " at offset %d", $fh->tell() - SIGNATURE_LENGTH ); } $status = _formatError("$errmsg in file $fileName"); } return ( $status, $signature ); } # Utility method to make and open a temp file. # Will create $temp_dir if it doesn't exist. # Returns file handle and name: # # my ($fh, $name) = Archive::Zip::tempFile(); # my ($fh, $name) = Archive::Zip::tempFile('mytempdir'); # sub tempFile { my $dir = ( ref( $_[0] ) eq 'HASH' ) ? shift->{tempDir} : shift; my ( $fh, $filename ) = File::Temp::tempfile( SUFFIX => '.zip', UNLINK => 0, # we will delete it! $dir ? ( DIR => $dir ) : () ); return ( undef, undef ) unless $fh; my ( $status, $newfh ) = _newFileHandle( $fh, 'w+' ); return ( $newfh, $filename ); } # Return the normalized directory name as used in a zip file (path # separators become slashes, etc.). # Will translate internal slashes in path components (i.e. on Macs) to # underscores. Discards volume names. # When $forceDir is set, returns paths with trailing slashes (or arrays # with trailing blank members). # # If third argument is a reference, returns volume information there. # # input output # . ('.') '.' # ./a ('a') a # ./a/b ('a','b') a/b # ./a/b/ ('a','b') a/b # a/b/ ('a','b') a/b # /a/b/ ('','a','b') /a/b # c:\a\b\c.doc ('','a','b','c.doc') /a/b/c.doc # on Windoze # "i/o maps:whatever" ('i_o maps', 'whatever') "i_o maps/whatever" # on Macs sub _asZipDirName { my $name = shift; my $forceDir = shift; my $volReturn = shift; my ( $volume, $directories, $file ) = File::Spec->splitpath( File::Spec->canonpath($name), $forceDir ); $$volReturn = $volume if ( ref($volReturn) ); my @dirs = map { $_ =~ s{/}{_}g; $_ } File::Spec->splitdir($directories); if ( @dirs > 0 ) { pop (@dirs) unless $dirs[-1] } # remove empty component push ( @dirs, defined($file) ? $file : '' ); #return wantarray ? @dirs : join ( '/', @dirs ); return join ( '/', @dirs ); } # Return an absolute local name for a zip name. # Assume a directory if zip name has trailing slash. # Takes an optional volume name in FS format (like 'a:'). # sub _asLocalName { my $name = shift; # zip format my $volume = shift; $volume = '' unless defined($volume); # local FS format my @paths = split ( /\//, $name ); my $filename = pop (@paths); $filename = '' unless defined($filename); my $localDirs = @paths ? File::Spec->catdir(@paths) : ''; my $localName = File::Spec->catpath( $volume, $localDirs, $filename ); unless ( $volume ) { $localName = File::Spec->rel2abs( $localName, Cwd::getcwd() ); } return $localName; } 1; __END__ #line 2060 FILE19a1894b/Archive/Zip/Archive.pms#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/Archive.pm" package Archive::Zip::Archive; # Represents a generic ZIP archive use strict; use File::Path; use File::Find (); use File::Spec (); use File::Copy (); use File::Basename; use Cwd; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw( Archive::Zip ); } use Archive::Zip qw( :CONSTANTS :ERROR_CODES :PKZIP_CONSTANTS :UTILITY_METHODS ); # Note that this returns undef on read errors, else new zip object. sub new { my $class = shift; my $self = bless( { 'diskNumber' => 0, 'diskNumberWithStartOfCentralDirectory' => 0, 'numberOfCentralDirectoriesOnThisDisk' => 0, # shld be # of members 'numberOfCentralDirectories' => 0, # shld be # of members 'centralDirectorySize' => 0, # must re-compute on write 'centralDirectoryOffsetWRTStartingDiskNumber' => 0, # must re-compute 'writeEOCDOffset' => 0, 'writeCentralDirectoryOffset' => 0, 'zipfileComment' => '', 'eocdOffset' => 0, 'fileName' => '' }, $class ); $self->{'members'} = []; my $fileName = ( ref( $_[0] ) eq 'HASH' ) ? shift->{filename} : shift; if ($fileName) { my $status = $self->read($fileName); return $status == AZ_OK ? $self : undef; } return $self; } sub storeSymbolicLink { my $self = shift; $self->{'storeSymbolicLink'} = shift; } sub members { @{ shift->{'members'} }; } sub numberOfMembers { scalar( shift->members() ); } sub memberNames { my $self = shift; return map { $_->fileName() } $self->members(); } # return ref to member with given name or undef sub memberNamed { my $self = shift; my $fileName = ( ref( $_[0] ) eq 'HASH' ) ? shift->{zipName} : shift; foreach my $member ( $self->members() ) { return $member if $member->fileName() eq $fileName; } return undef; } sub membersMatching { my $self = shift; my $pattern = ( ref( $_[0] ) eq 'HASH' ) ? shift->{regex} : shift; return grep { $_->fileName() =~ /$pattern/ } $self->members(); } sub diskNumber { shift->{'diskNumber'}; } sub diskNumberWithStartOfCentralDirectory { shift->{'diskNumberWithStartOfCentralDirectory'}; } sub numberOfCentralDirectoriesOnThisDisk { shift->{'numberOfCentralDirectoriesOnThisDisk'}; } sub numberOfCentralDirectories { shift->{'numberOfCentralDirectories'}; } sub centralDirectorySize { shift->{'centralDirectorySize'}; } sub centralDirectoryOffsetWRTStartingDiskNumber { shift->{'centralDirectoryOffsetWRTStartingDiskNumber'}; } sub zipfileComment { my $self = shift; my $comment = $self->{'zipfileComment'}; if (@_) { my $new_comment = ( ref( $_[0] ) eq 'HASH' ) ? shift->{comment} : shift; $self->{'zipfileComment'} = pack( 'C0a*', $new_comment ); # avoid unicode } return $comment; } sub eocdOffset { shift->{'eocdOffset'}; } # Return the name of the file last read. sub fileName { shift->{'fileName'}; } sub removeMember { my $self = shift; my $member = ( ref( $_[0] ) eq 'HASH' ) ? shift->{memberOrZipName} : shift; $member = $self->memberNamed($member) unless ref($member); return undef unless $member; my @newMembers = grep { $_ != $member } $self->members(); $self->{'members'} = \@newMembers; return $member; } sub replaceMember { my $self = shift; my ( $oldMember, $newMember ); if ( ref( $_[0] ) eq 'HASH' ) { $oldMember = $_[0]->{memberOrZipName}; $newMember = $_[0]->{newMember}; } else { ( $oldMember, $newMember ) = @_; } $oldMember = $self->memberNamed($oldMember) unless ref($oldMember); return undef unless $oldMember; return undef unless $newMember; my @newMembers = map { ( $_ == $oldMember ) ? $newMember : $_ } $self->members(); $self->{'members'} = \@newMembers; return $oldMember; } sub extractMember { my $self = shift; my ( $member, $name ); if ( ref( $_[0] ) eq 'HASH' ) { $member = $_[0]->{memberOrZipName}; $name = $_[0]->{name}; } else { ( $member, $name ) = @_; } $member = $self->memberNamed($member) unless ref($member); return _error('member not found') unless $member; my $originalSize = $member->compressedSize(); my ( $volumeName, $dirName, $fileName ); if ( defined($name) ) { ( $volumeName, $dirName, $fileName ) = File::Spec->splitpath($name); $dirName = File::Spec->catpath( $volumeName, $dirName, '' ); } else { $name = $member->fileName(); ( $dirName = $name ) =~ s{[^/]*$}{}; $dirName = Archive::Zip::_asLocalName($dirName); $name = Archive::Zip::_asLocalName($name); } if ( $dirName && !-d $dirName ) { mkpath($dirName); return _ioError("can't create dir $dirName") if ( !-d $dirName ); } my $rc = $member->extractToFileNamed( $name, @_ ); # TODO refactor this fix into extractToFileNamed() $member->{'compressedSize'} = $originalSize; return $rc; } sub extractMemberWithoutPaths { my $self = shift; my ( $member, $name ); if ( ref( $_[0] ) eq 'HASH' ) { $member = $_[0]->{memberOrZipName}; $name = $_[0]->{name}; } else { ( $member, $name ) = @_; } $member = $self->memberNamed($member) unless ref($member); return _error('member not found') unless $member; my $originalSize = $member->compressedSize(); return AZ_OK if $member->isDirectory(); unless ($name) { $name = $member->fileName(); $name =~ s{.*/}{}; # strip off directories, if any $name = Archive::Zip::_asLocalName($name); } my $rc = $member->extractToFileNamed( $name, @_ ); $member->{'compressedSize'} = $originalSize; return $rc; } sub addMember { my $self = shift; my $newMember = ( ref( $_[0] ) eq 'HASH' ) ? shift->{member} : shift; push( @{ $self->{'members'} }, $newMember ) if $newMember; return $newMember; } sub addFile { my $self = shift; my ( $fileName, $newName, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $fileName = $_[0]->{filename}; $newName = $_[0]->{zipName}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $fileName, $newName, $compressionLevel ) = @_; } my $newMember = $self->ZIPMEMBERCLASS->newFromFile( $fileName, $newName ); $newMember->desiredCompressionLevel($compressionLevel); if ( $self->{'storeSymbolicLink'} && -l $fileName ) { my $newMember = $self->ZIPMEMBERCLASS->newFromString(readlink $fileName, $newName); # For symbolic links, External File Attribute is set to 0xA1FF0000 by Info-ZIP $newMember->{'externalFileAttributes'} = 0xA1FF0000; $self->addMember($newMember); } else { $self->addMember($newMember); } return $newMember; } sub addString { my $self = shift; my ( $stringOrStringRef, $name, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $stringOrStringRef = $_[0]->{string}; $name = $_[0]->{zipName}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $stringOrStringRef, $name, $compressionLevel ) = @_;; } my $newMember = $self->ZIPMEMBERCLASS->newFromString( $stringOrStringRef, $name ); $newMember->desiredCompressionLevel($compressionLevel); return $self->addMember($newMember); } sub addDirectory { my $self = shift; my ( $name, $newName ); if ( ref( $_[0] ) eq 'HASH' ) { $name = $_[0]->{directoryName}; $newName = $_[0]->{zipName}; } else { ( $name, $newName ) = @_; } my $newMember = $self->ZIPMEMBERCLASS->newDirectoryNamed( $name, $newName ); if ( $self->{'storeSymbolicLink'} && -l $name ) { my $link = readlink $name; ( $newName =~ s{/$}{} ) if $newName; # Strip trailing / my $newMember = $self->ZIPMEMBERCLASS->newFromString($link, $newName); # For symbolic links, External File Attribute is set to 0xA1FF0000 by Info-ZIP $newMember->{'externalFileAttributes'} = 0xA1FF0000; $self->addMember($newMember); } else { $self->addMember($newMember); } return $newMember; } # add either a file or a directory. sub addFileOrDirectory { my $self = shift; my ( $name, $newName, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $name = $_[0]->{name}; $newName = $_[0]->{zipName}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $name, $newName, $compressionLevel ) = @_; } $name =~ s{/$}{}; if ( $newName ) { $newName =~ s{/$}{}; } else { $newName = $name; } if ( -f $name ) { return $self->addFile( $name, $newName, $compressionLevel ); } elsif ( -d $name ) { return $self->addDirectory( $name, $newName ); } else { return _error("$name is neither a file nor a directory"); } } sub contents { my $self = shift; my ( $member, $newContents ); if ( ref( $_[0] ) eq 'HASH' ) { $member = $_[0]->{memberOrZipName}; $newContents = $_[0]->{contents}; } else { ( $member, $newContents ) = @_; } return _error('No member name given') unless $member; $member = $self->memberNamed($member) unless ref($member); return undef unless $member; return $member->contents($newContents); } sub writeToFileNamed { my $self = shift; my $fileName = ( ref( $_[0] ) eq 'HASH' ) ? shift->{filename} : shift; # local FS format foreach my $member ( $self->members() ) { if ( $member->_usesFileNamed($fileName) ) { return _error( "$fileName is needed by member " . $member->fileName() . "; consider using overwrite() or overwriteAs() instead." ); } } my ( $status, $fh ) = _newFileHandle( $fileName, 'w' ); return _ioError("Can't open $fileName for write") unless $status; my $retval = $self->writeToFileHandle( $fh, 1 ); $fh->close(); $fh = undef; return $retval; } # It is possible to write data to the FH before calling this, # perhaps to make a self-extracting archive. sub writeToFileHandle { my $self = shift; my ( $fh, $fhIsSeekable ); if ( ref( $_[0] ) eq 'HASH' ) { $fh = $_[0]->{fileHandle}; $fhIsSeekable = exists( $_[0]->{seek} ) ? $_[0]->{seek} : _isSeekable($fh); } else { $fh = shift; $fhIsSeekable = @_ ? shift : _isSeekable($fh); } return _error('No filehandle given') unless $fh; return _ioError('filehandle not open') unless $fh->opened(); _binmode($fh); # Find out where the current position is. my $offset = $fhIsSeekable ? $fh->tell() : 0; $offset = 0 if $offset < 0; foreach my $member ( $self->members() ) { my $retval = $member->_writeToFileHandle( $fh, $fhIsSeekable, $offset ); $member->endRead(); return $retval if $retval != AZ_OK; $offset += $member->_localHeaderSize() + $member->_writeOffset(); $offset += $member->hasDataDescriptor() ? DATA_DESCRIPTOR_LENGTH + SIGNATURE_LENGTH : 0; # changed this so it reflects the last successful position $self->{'writeCentralDirectoryOffset'} = $offset; } return $self->writeCentralDirectory($fh); } # Write zip back to the original file, # as safely as possible. # Returns AZ_OK if successful. sub overwrite { my $self = shift; return $self->overwriteAs( $self->{'fileName'} ); } # Write zip to the specified file, # as safely as possible. # Returns AZ_OK if successful. sub overwriteAs { my $self = shift; my $zipName = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{filename} : shift; return _error("no filename in overwriteAs()") unless defined($zipName); my ( $fh, $tempName ) = Archive::Zip::tempFile(); return _error( "Can't open temp file", $! ) unless $fh; ( my $backupName = $zipName ) =~ s{(\.[^.]*)?$}{.zbk}; my $status = $self->writeToFileHandle($fh); $fh->close(); $fh = undef; if ( $status != AZ_OK ) { unlink($tempName); _printError("Can't write to $tempName"); return $status; } my $err; # rename the zip if ( -f $zipName && !rename( $zipName, $backupName ) ) { $err = $!; unlink($tempName); return _error( "Can't rename $zipName as $backupName", $err ); } # move the temp to the original name (possibly copying) unless ( File::Copy::move( $tempName, $zipName ) ) { $err = $!; rename( $backupName, $zipName ); unlink($tempName); return _error( "Can't move $tempName to $zipName", $err ); } # unlink the backup if ( -f $backupName && !unlink($backupName) ) { $err = $!; return _error( "Can't unlink $backupName", $err ); } return AZ_OK; } # Used only during writing sub _writeCentralDirectoryOffset { shift->{'writeCentralDirectoryOffset'}; } sub _writeEOCDOffset { shift->{'writeEOCDOffset'}; } # Expects to have _writeEOCDOffset() set sub _writeEndOfCentralDirectory { my ( $self, $fh ) = @_; $self->_print($fh, END_OF_CENTRAL_DIRECTORY_SIGNATURE_STRING) or return _ioError('writing EOCD Signature'); my $zipfileCommentLength = length( $self->zipfileComment() ); my $header = pack( END_OF_CENTRAL_DIRECTORY_FORMAT, 0, # {'diskNumber'}, 0, # {'diskNumberWithStartOfCentralDirectory'}, $self->numberOfMembers(), # {'numberOfCentralDirectoriesOnThisDisk'}, $self->numberOfMembers(), # {'numberOfCentralDirectories'}, $self->_writeEOCDOffset() - $self->_writeCentralDirectoryOffset(), $self->_writeCentralDirectoryOffset(), $zipfileCommentLength ); $self->_print($fh, $header) or return _ioError('writing EOCD header'); if ($zipfileCommentLength) { $self->_print($fh, $self->zipfileComment() ) or return _ioError('writing zipfile comment'); } return AZ_OK; } # $offset can be specified to truncate a zip file. sub writeCentralDirectory { my $self = shift; my ( $fh, $offset ); if ( ref( $_[0] ) eq 'HASH' ) { $fh = $_[0]->{fileHandle}; $offset = $_[0]->{offset}; } else { ( $fh, $offset ) = @_; } if ( defined($offset) ) { $self->{'writeCentralDirectoryOffset'} = $offset; $fh->seek( $offset, IO::Seekable::SEEK_SET ) or return _ioError('seeking to write central directory'); } else { $offset = $self->_writeCentralDirectoryOffset(); } foreach my $member ( $self->members() ) { my $status = $member->_writeCentralDirectoryFileHeader($fh); return $status if $status != AZ_OK; $offset += $member->_centralDirectoryHeaderSize(); $self->{'writeEOCDOffset'} = $offset; } return $self->_writeEndOfCentralDirectory($fh); } sub read { my $self = shift; my $fileName = ( ref( $_[0] ) eq 'HASH' ) ? shift->{filename} : shift; return _error('No filename given') unless $fileName; my ( $status, $fh ) = _newFileHandle( $fileName, 'r' ); return _ioError("opening $fileName for read") unless $status; $status = $self->readFromFileHandle( $fh, $fileName ); return $status if $status != AZ_OK; $fh->close(); $self->{'fileName'} = $fileName; return AZ_OK; } sub readFromFileHandle { my $self = shift; my ( $fh, $fileName ); if ( ref( $_[0] ) eq 'HASH' ) { $fh = $_[0]->{fileHandle}; $fileName = $_[0]->{filename}; } else { ( $fh, $fileName ) = @_; } $fileName = $fh unless defined($fileName); return _error('No filehandle given') unless $fh; return _ioError('filehandle not open') unless $fh->opened(); _binmode($fh); $self->{'fileName'} = "$fh"; # TODO: how to support non-seekable zips? return _error('file not seekable') unless _isSeekable($fh); $fh->seek( 0, 0 ); # rewind the file my $status = $self->_findEndOfCentralDirectory($fh); return $status if $status != AZ_OK; my $eocdPosition = $fh->tell(); $status = $self->_readEndOfCentralDirectory($fh); return $status if $status != AZ_OK; $fh->seek( $eocdPosition - $self->centralDirectorySize(), IO::Seekable::SEEK_SET ) or return _ioError("Can't seek $fileName"); # Try to detect garbage at beginning of archives # This should be 0 $self->{'eocdOffset'} = $eocdPosition - $self->centralDirectorySize() # here - $self->centralDirectoryOffsetWRTStartingDiskNumber(); for ( ; ; ) { my $newMember = $self->ZIPMEMBERCLASS->_newFromZipFile( $fh, $fileName, $self->eocdOffset() ); my $signature; ( $status, $signature ) = _readSignature( $fh, $fileName ); return $status if $status != AZ_OK; last if $signature == END_OF_CENTRAL_DIRECTORY_SIGNATURE; $status = $newMember->_readCentralDirectoryFileHeader(); return $status if $status != AZ_OK; $status = $newMember->endRead(); return $status if $status != AZ_OK; $newMember->_becomeDirectoryIfNecessary(); push( @{ $self->{'members'} }, $newMember ); } return AZ_OK; } # Read EOCD, starting from position before signature. # Return AZ_OK on success. sub _readEndOfCentralDirectory { my $self = shift; my $fh = shift; # Skip past signature $fh->seek( SIGNATURE_LENGTH, IO::Seekable::SEEK_CUR ) or return _ioError("Can't seek past EOCD signature"); my $header = ''; my $bytesRead = $fh->read( $header, END_OF_CENTRAL_DIRECTORY_LENGTH ); if ( $bytesRead != END_OF_CENTRAL_DIRECTORY_LENGTH ) { return _ioError("reading end of central directory"); } my $zipfileCommentLength; ( $self->{'diskNumber'}, $self->{'diskNumberWithStartOfCentralDirectory'}, $self->{'numberOfCentralDirectoriesOnThisDisk'}, $self->{'numberOfCentralDirectories'}, $self->{'centralDirectorySize'}, $self->{'centralDirectoryOffsetWRTStartingDiskNumber'}, $zipfileCommentLength ) = unpack( END_OF_CENTRAL_DIRECTORY_FORMAT, $header ); if ($zipfileCommentLength) { my $zipfileComment = ''; $bytesRead = $fh->read( $zipfileComment, $zipfileCommentLength ); if ( $bytesRead != $zipfileCommentLength ) { return _ioError("reading zipfile comment"); } $self->{'zipfileComment'} = $zipfileComment; } return AZ_OK; } # Seek in my file to the end, then read backwards until we find the # signature of the central directory record. Leave the file positioned right # before the signature. Returns AZ_OK if success. sub _findEndOfCentralDirectory { my $self = shift; my $fh = shift; my $data = ''; $fh->seek( 0, IO::Seekable::SEEK_END ) or return _ioError("seeking to end"); my $fileLength = $fh->tell(); if ( $fileLength < END_OF_CENTRAL_DIRECTORY_LENGTH + 4 ) { return _formatError("file is too short"); } my $seekOffset = 0; my $pos = -1; for ( ; ; ) { $seekOffset += 512; $seekOffset = $fileLength if ( $seekOffset > $fileLength ); $fh->seek( -$seekOffset, IO::Seekable::SEEK_END ) or return _ioError("seek failed"); my $bytesRead = $fh->read( $data, $seekOffset ); if ( $bytesRead != $seekOffset ) { return _ioError("read failed"); } $pos = rindex( $data, END_OF_CENTRAL_DIRECTORY_SIGNATURE_STRING ); last if ( $pos >= 0 or $seekOffset == $fileLength or $seekOffset >= $Archive::Zip::ChunkSize ); } if ( $pos >= 0 ) { $fh->seek( $pos - $seekOffset, IO::Seekable::SEEK_CUR ) or return _ioError("seeking to EOCD"); return AZ_OK; } else { return _formatError("can't find EOCD signature"); } } # Used to avoid taint problems when chdir'ing. # Not intended to increase security in any way; just intended to shut up the -T # complaints. If your Cwd module is giving you unreliable returns from cwd() # you have bigger problems than this. sub _untaintDir { my $dir = shift; $dir =~ m/\A(.+)\z/s; return $1; } sub addTree { my $self = shift; my ( $root, $dest, $pred, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $root = $_[0]->{root}; $dest = $_[0]->{zipName}; $pred = $_[0]->{select}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $root, $dest, $pred, $compressionLevel ) = @_; } return _error("root arg missing in call to addTree()") unless defined($root); $dest = '' unless defined($dest); $pred = sub { -r } unless defined($pred); my @files; my $startDir = _untaintDir( cwd() ); return _error( 'undef returned by _untaintDir on cwd ', cwd() ) unless $startDir; # This avoids chdir'ing in Find, in a way compatible with older # versions of File::Find. my $wanted = sub { local $main::_ = $File::Find::name; my $dir = _untaintDir($File::Find::dir); chdir($startDir); push( @files, $File::Find::name ) if (&$pred); chdir($dir); }; File::Find::find( $wanted, $root ); my $rootZipName = _asZipDirName( $root, 1 ); # with trailing slash my $pattern = $rootZipName eq './' ? '^' : "^\Q$rootZipName\E"; $dest = _asZipDirName( $dest, 1 ); # with trailing slash foreach my $fileName (@files) { my $isDir = -d $fileName; # normalize, remove leading ./ my $archiveName = _asZipDirName( $fileName, $isDir ); if ( $archiveName eq $rootZipName ) { $archiveName = $dest } else { $archiveName =~ s{$pattern}{$dest} } next if $archiveName =~ m{^\.?/?$}; # skip current dir my $member = $isDir ? $self->addDirectory( $fileName, $archiveName ) : $self->addFile( $fileName, $archiveName ); $member->desiredCompressionLevel($compressionLevel); return _error("add $fileName failed in addTree()") if !$member; } return AZ_OK; } sub addTreeMatching { my $self = shift; my ( $root, $dest, $pattern, $pred, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $root = $_[0]->{root}; $dest = $_[0]->{zipName}; $pattern = $_[0]->{pattern}; $pred = $_[0]->{select}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $root, $dest, $pattern, $pred, $compressionLevel ) = @_; } return _error("root arg missing in call to addTreeMatching()") unless defined($root); $dest = '' unless defined($dest); return _error("pattern missing in call to addTreeMatching()") unless defined($pattern); my $matcher = $pred ? sub { m{$pattern} && &$pred } : sub { m{$pattern} && -r }; return $self->addTree( $root, $dest, $matcher, $compressionLevel ); } # $zip->extractTree( $root, $dest [, $volume] ); # # $root and $dest are Unix-style. # $volume is in local FS format. # sub extractTree { my $self = shift; my ( $root, $dest, $volume ); if ( ref( $_[0] ) eq 'HASH' ) { $root = $_[0]->{root}; $dest = $_[0]->{zipName}; $volume = $_[0]->{volume}; } else { ( $root, $dest, $volume ) = @_; } $root = '' unless defined($root); $dest = './' unless defined($dest); my $pattern = "^\Q$root"; my @members = $self->membersMatching($pattern); foreach my $member (@members) { my $fileName = $member->fileName(); # in Unix format $fileName =~ s{$pattern}{$dest}; # in Unix format # convert to platform format: $fileName = Archive::Zip::_asLocalName( $fileName, $volume ); my $status = $member->extractToFileNamed($fileName); return $status if $status != AZ_OK; } return AZ_OK; } # $zip->updateMember( $memberOrName, $fileName ); # Returns (possibly updated) member, if any; undef on errors. sub updateMember { my $self = shift; my ( $oldMember, $fileName ); if ( ref( $_[0] ) eq 'HASH' ) { $oldMember = $_[0]->{memberOrZipName}; $fileName = $_[0]->{name}; } else { ( $oldMember, $fileName ) = @_; } if ( !defined($fileName) ) { _error("updateMember(): missing fileName argument"); return undef; } my @newStat = stat($fileName); if ( !@newStat ) { _ioError("Can't stat $fileName"); return undef; } my $isDir = -d _; my $memberName; if ( ref($oldMember) ) { $memberName = $oldMember->fileName(); } else { $oldMember = $self->memberNamed( $memberName = $oldMember ) || $self->memberNamed( $memberName = _asZipDirName( $oldMember, $isDir ) ); } unless ( defined($oldMember) && $oldMember->lastModTime() == $newStat[9] && $oldMember->isDirectory() == $isDir && ( $isDir || ( $oldMember->uncompressedSize() == $newStat[7] ) ) ) { # create the new member my $newMember = $isDir ? $self->ZIPMEMBERCLASS->newDirectoryNamed( $fileName, $memberName ) : $self->ZIPMEMBERCLASS->newFromFile( $fileName, $memberName ); unless ( defined($newMember) ) { _error("creation of member $fileName failed in updateMember()"); return undef; } # replace old member or append new one if ( defined($oldMember) ) { $self->replaceMember( $oldMember, $newMember ); } else { $self->addMember($newMember); } return $newMember; } return $oldMember; } # $zip->updateTree( $root, [ $dest, [ $pred [, $mirror]]] ); # # This takes the same arguments as addTree, but first checks to see # whether the file or directory already exists in the zip file. # # If the fourth argument $mirror is true, then delete all my members # if corresponding files weren't found. sub updateTree { my $self = shift; my ( $root, $dest, $pred, $mirror, $compressionLevel ); if ( ref( $_[0] ) eq 'HASH' ) { $root = $_[0]->{root}; $dest = $_[0]->{zipName}; $pred = $_[0]->{select}; $mirror = $_[0]->{mirror}; $compressionLevel = $_[0]->{compressionLevel}; } else { ( $root, $dest, $pred, $mirror, $compressionLevel ) = @_; } return _error("root arg missing in call to updateTree()") unless defined($root); $dest = '' unless defined($dest); $pred = sub { -r } unless defined($pred); $dest = _asZipDirName( $dest, 1 ); my $rootZipName = _asZipDirName( $root, 1 ); # with trailing slash my $pattern = $rootZipName eq './' ? '^' : "^\Q$rootZipName\E"; my @files; my $startDir = _untaintDir( cwd() ); return _error( 'undef returned by _untaintDir on cwd ', cwd() ) unless $startDir; # This avoids chdir'ing in Find, in a way compatible with older # versions of File::Find. my $wanted = sub { local $main::_ = $File::Find::name; my $dir = _untaintDir($File::Find::dir); chdir($startDir); push( @files, $File::Find::name ) if (&$pred); chdir($dir); }; File::Find::find( $wanted, $root ); # Now @files has all the files that I could potentially be adding to # the zip. Only add the ones that are necessary. # For each file (updated or not), add its member name to @done. my %done; foreach my $fileName (@files) { my @newStat = stat($fileName); my $isDir = -d _; # normalize, remove leading ./ my $memberName = _asZipDirName( $fileName, $isDir ); if ( $memberName eq $rootZipName ) { $memberName = $dest } else { $memberName =~ s{$pattern}{$dest} } next if $memberName =~ m{^\.?/?$}; # skip current dir $done{$memberName} = 1; my $changedMember = $self->updateMember( $memberName, $fileName ); $changedMember->desiredCompressionLevel($compressionLevel); return _error("updateTree failed to update $fileName") unless ref($changedMember); } # @done now has the archive names corresponding to all the found files. # If we're mirroring, delete all those members that aren't in @done. if ($mirror) { foreach my $member ( $self->members() ) { $self->removeMember($member) unless $done{ $member->fileName() }; } } return AZ_OK; } 1; FILE'a3862706/Archive/Zip/DirectoryMember.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/DirectoryMember.pm" package Archive::Zip::DirectoryMember; use strict; use File::Path; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw( Archive::Zip::Member ); } use Archive::Zip qw( :ERROR_CODES :UTILITY_METHODS ); sub _newNamed { my $class = shift; my $fileName = shift; # FS name my $newName = shift; # Zip name $newName = _asZipDirName($fileName) unless $newName; my $self = $class->new(@_); $self->{'externalFileName'} = $fileName; $self->fileName($newName); if ( -e $fileName ) { # -e does NOT do a full stat, so we need to do one now if ( -d _ ) { my @stat = stat(_); $self->unixFileAttributes( $stat[2] ); my $mod_t = $stat[9]; if ( $^O eq 'MSWin32' and !$mod_t ) { $mod_t = time(); } $self->setLastModFileDateTimeFromUnix($mod_t); } else { # hmm.. trying to add a non-directory? _error( $fileName, ' exists but is not a directory' ); return undef; } } else { $self->unixFileAttributes( $self->DEFAULT_DIRECTORY_PERMISSIONS ); $self->setLastModFileDateTimeFromUnix( time() ); } return $self; } sub externalFileName { shift->{'externalFileName'}; } sub isDirectory { return 1; } sub extractToFileNamed { my $self = shift; my $name = shift; # local FS name my $attribs = $self->unixFileAttributes() & 07777; mkpath( $name, 0, $attribs ); # croaks on error utime( $self->lastModTime(), $self->lastModTime(), $name ); return AZ_OK; } sub fileName { my $self = shift; my $newName = shift; $newName =~ s{/?$}{/} if defined($newName); return $self->SUPER::fileName($newName); } # So people don't get too confused. This way it looks like the problem # is in their code... sub contents { return wantarray ? ( undef, AZ_OK ) : undef; } 1; FILE"2187361e/Archive/Zip/FileMember.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/FileMember.pm" package Archive::Zip::FileMember; use strict; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw ( Archive::Zip::Member ); } use Archive::Zip qw( :UTILITY_METHODS ); sub externalFileName { shift->{'externalFileName'}; } # Return true if I depend on the named file sub _usesFileNamed { my $self = shift; my $fileName = shift; my $xfn = $self->externalFileName(); return undef if ref($xfn); return $xfn eq $fileName; } sub fh { my $self = shift; $self->_openFile() if !defined( $self->{'fh'} ) || !$self->{'fh'}->opened(); return $self->{'fh'}; } # opens my file handle from my file name sub _openFile { my $self = shift; my ( $status, $fh ) = _newFileHandle( $self->externalFileName(), 'r' ); if ( !$status ) { _ioError( "Can't open", $self->externalFileName() ); return undef; } $self->{'fh'} = $fh; _binmode($fh); return $fh; } # Make sure I close my file handle sub endRead { my $self = shift; undef $self->{'fh'}; # _closeFile(); return $self->SUPER::endRead(@_); } sub _become { my $self = shift; my $newClass = shift; return $self if ref($self) eq $newClass; delete( $self->{'externalFileName'} ); delete( $self->{'fh'} ); return $self->SUPER::_become($newClass); } 1; FILEa149da94/Archive/Zip/Member.pmT#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/Member.pm" package Archive::Zip::Member; # A generic membet of an archive use strict; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw( Archive::Zip ); } use Archive::Zip qw( :CONSTANTS :MISC_CONSTANTS :ERROR_CODES :PKZIP_CONSTANTS :UTILITY_METHODS ); use Time::Local (); use Compress::Raw::Zlib qw( Z_OK Z_STREAM_END MAX_WBITS ); use File::Path; use File::Basename; use constant ZIPFILEMEMBERCLASS => 'Archive::Zip::ZipFileMember'; use constant NEWFILEMEMBERCLASS => 'Archive::Zip::NewFileMember'; use constant STRINGMEMBERCLASS => 'Archive::Zip::StringMember'; use constant DIRECTORYMEMBERCLASS => 'Archive::Zip::DirectoryMember'; # Unix perms for default creation of files/dirs. use constant DEFAULT_DIRECTORY_PERMISSIONS => 040755; use constant DEFAULT_FILE_PERMISSIONS => 0100666; use constant DIRECTORY_ATTRIB => 040000; use constant FILE_ATTRIB => 0100000; # Returns self if successful, else undef # Assumes that fh is positioned at beginning of central directory file header. # Leaves fh positioned immediately after file header or EOCD signature. sub _newFromZipFile { my $class = shift; my $self = $class->ZIPFILEMEMBERCLASS->_newFromZipFile(@_); return $self; } sub newFromString { my $class = shift; my ( $stringOrStringRef, $fileName ); if ( ref( $_[0] ) eq 'HASH' ) { $stringOrStringRef = $_[0]->{string}; $fileName = $_[0]->{zipName}; } else { ( $stringOrStringRef, $fileName ) = @_; } my $self = $class->STRINGMEMBERCLASS->_newFromString( $stringOrStringRef, $fileName ); return $self; } sub newFromFile { my $class = shift; my ( $fileName, $zipName ); if ( ref( $_[0] ) eq 'HASH' ) { $fileName = $_[0]->{fileName}; $zipName = $_[0]->{zipName}; } else { ( $fileName, $zipName ) = @_; } my $self = $class->NEWFILEMEMBERCLASS->_newFromFileNamed( $fileName, $zipName ); return $self; } sub newDirectoryNamed { my $class = shift; my ( $directoryName, $newName ); if ( ref( $_[0] ) eq 'HASH' ) { $directoryName = $_[0]->{directoryName}; $newName = $_[0]->{zipName}; } else { ( $directoryName, $newName ) = @_; } my $self = $class->DIRECTORYMEMBERCLASS->_newNamed( $directoryName, $newName ); return $self; } sub new { my $class = shift; my $self = { 'lastModFileDateTime' => 0, 'fileAttributeFormat' => FA_UNIX, 'versionMadeBy' => 20, 'versionNeededToExtract' => 20, 'bitFlag' => 0, 'compressionMethod' => COMPRESSION_STORED, 'desiredCompressionMethod' => COMPRESSION_STORED, 'desiredCompressionLevel' => COMPRESSION_LEVEL_NONE, 'internalFileAttributes' => 0, 'externalFileAttributes' => 0, # set later 'fileName' => '', 'cdExtraField' => '', 'localExtraField' => '', 'fileComment' => '', 'crc32' => 0, 'compressedSize' => 0, 'uncompressedSize' => 0, 'isSymbolicLink' => 0, @_ }; bless( $self, $class ); $self->unixFileAttributes( $self->DEFAULT_FILE_PERMISSIONS ); return $self; } sub _becomeDirectoryIfNecessary { my $self = shift; $self->_become(DIRECTORYMEMBERCLASS) if $self->isDirectory(); return $self; } # Morph into given class (do whatever cleanup I need to do) sub _become { return bless( $_[0], $_[1] ); } sub versionMadeBy { shift->{'versionMadeBy'}; } sub fileAttributeFormat { my $self = shift; if (@_) { $self->{fileAttributeFormat} = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{format} : $_[0]; } else { return $self->{fileAttributeFormat}; } } sub versionNeededToExtract { shift->{'versionNeededToExtract'}; } sub bitFlag { my $self = shift; # Set General Purpose Bit Flags according to the desiredCompressionLevel setting if ( $self->desiredCompressionLevel == 1 || $self->desiredCompressionLevel == 2 ) { $self->{'bitFlag'} = DEFLATING_COMPRESSION_FAST; } elsif ( $self->desiredCompressionLevel == 3 || $self->desiredCompressionLevel == 4 || $self->desiredCompressionLevel == 5 || $self->desiredCompressionLevel == 6 || $self->desiredCompressionLevel == 7 ) { $self->{'bitFlag'} = DEFLATING_COMPRESSION_NORMAL; } elsif ( $self->desiredCompressionLevel == 8 || $self->desiredCompressionLevel == 9 ) { $self->{'bitFlag'} = DEFLATING_COMPRESSION_MAXIMUM; } $self->{'bitFlag'}; } sub compressionMethod { shift->{'compressionMethod'}; } sub desiredCompressionMethod { my $self = shift; my $newDesiredCompressionMethod = ( ref( $_[0] ) eq 'HASH' ) ? shift->{compressionMethod} : shift; my $oldDesiredCompressionMethod = $self->{'desiredCompressionMethod'}; if ( defined($newDesiredCompressionMethod) ) { $self->{'desiredCompressionMethod'} = $newDesiredCompressionMethod; if ( $newDesiredCompressionMethod == COMPRESSION_STORED ) { $self->{'desiredCompressionLevel'} = 0; $self->{'bitFlag'} &= ~GPBF_HAS_DATA_DESCRIPTOR_MASK; } elsif ( $oldDesiredCompressionMethod == COMPRESSION_STORED ) { $self->{'desiredCompressionLevel'} = COMPRESSION_LEVEL_DEFAULT; } } return $oldDesiredCompressionMethod; } sub desiredCompressionLevel { my $self = shift; my $newDesiredCompressionLevel = ( ref( $_[0] ) eq 'HASH' ) ? shift->{compressionLevel} : shift; my $oldDesiredCompressionLevel = $self->{'desiredCompressionLevel'}; if ( defined($newDesiredCompressionLevel) ) { $self->{'desiredCompressionLevel'} = $newDesiredCompressionLevel; $self->{'desiredCompressionMethod'} = ( $newDesiredCompressionLevel ? COMPRESSION_DEFLATED : COMPRESSION_STORED ); } return $oldDesiredCompressionLevel; } sub fileName { my $self = shift; my $newName = shift; if ($newName) { $newName =~ s{[\\/]+}{/}g; # deal with dos/windoze problems $self->{'fileName'} = $newName; } return $self->{'fileName'}; } sub lastModFileDateTime { my $modTime = shift->{'lastModFileDateTime'}; $modTime =~ m/^(\d+)$/; # untaint return $1; } sub lastModTime { my $self = shift; return _dosToUnixTime( $self->lastModFileDateTime() ); } sub setLastModFileDateTimeFromUnix { my $self = shift; my $time_t = shift; $self->{'lastModFileDateTime'} = _unixToDosTime($time_t); } sub internalFileAttributes { shift->{'internalFileAttributes'}; } sub externalFileAttributes { shift->{'externalFileAttributes'}; } # Convert UNIX permissions into proper value for zip file # Usable as a function or a method sub _mapPermissionsFromUnix { my $self = shift; my $mode = shift; my $attribs = $mode << 16; # Microsoft Windows Explorer needs this bit set for directories if ( $mode & DIRECTORY_ATTRIB ) { $attribs |= 16; } return $attribs; # TODO: map more MS-DOS perms } # Convert ZIP permissions into Unix ones # # This was taken from Info-ZIP group's portable UnZip # zipfile-extraction program, version 5.50. # http://www.info-zip.org/pub/infozip/ # # See the mapattr() function in unix/unix.c # See the attribute format constants in unzpriv.h # # XXX Note that there's one situation that isn't implemented # yet that depends on the "extra field." sub _mapPermissionsToUnix { my $self = shift; my $format = $self->{'fileAttributeFormat'}; my $attribs = $self->{'externalFileAttributes'}; my $mode = 0; if ( $format == FA_AMIGA ) { $attribs = $attribs >> 17 & 7; # Amiga RWE bits $mode = $attribs << 6 | $attribs << 3 | $attribs; return $mode; } if ( $format == FA_THEOS ) { $attribs &= 0xF1FFFFFF; if ( ( $attribs & 0xF0000000 ) != 0x40000000 ) { $attribs &= 0x01FFFFFF; # not a dir, mask all ftype bits } else { $attribs &= 0x41FFFFFF; # leave directory bit as set } } if ( $format == FA_UNIX || $format == FA_VAX_VMS || $format == FA_ACORN || $format == FA_ATARI_ST || $format == FA_BEOS || $format == FA_QDOS || $format == FA_TANDEM ) { $mode = $attribs >> 16; return $mode if $mode != 0 or not $self->localExtraField; # warn("local extra field is: ", $self->localExtraField, "\n"); # XXX This condition is not implemented # I'm just including the comments from the info-zip section for now. # Some (non-Info-ZIP) implementations of Zip for Unix and # VMS (and probably others ??) leave 0 in the upper 16-bit # part of the external_file_attributes field. Instead, they # store file permission attributes in some extra field. # As a work-around, we search for the presence of one of # these extra fields and fall back to the MSDOS compatible # part of external_file_attributes if one of the known # e.f. types has been detected. # Later, we might implement extraction of the permission # bits from the VMS extra field. But for now, the work-around # should be sufficient to provide "readable" extracted files. # (For ASI Unix e.f., an experimental remap from the e.f. # mode value IS already provided!) } # PKWARE's PKZip for Unix marks entries as FA_MSDOS, but stores the # Unix attributes in the upper 16 bits of the external attributes # field, just like Info-ZIP's Zip for Unix. We try to use that # value, after a check for consistency with the MSDOS attribute # bits (see below). if ( $format == FA_MSDOS ) { $mode = $attribs >> 16; } # FA_MSDOS, FA_OS2_HPFS, FA_WINDOWS_NTFS, FA_MACINTOSH, FA_TOPS20 $attribs = !( $attribs & 1 ) << 1 | ( $attribs & 0x10 ) >> 4; # keep previous $mode setting when its "owner" # part appears to be consistent with DOS attribute flags! return $mode if ( $mode & 0700 ) == ( 0400 | $attribs << 6 ); $mode = 0444 | $attribs << 6 | $attribs << 3 | $attribs; return $mode; } sub unixFileAttributes { my $self = shift; my $oldPerms = $self->_mapPermissionsToUnix; my $perms; if ( @_ ) { $perms = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{attributes} : $_[0]; if ( $self->isDirectory ) { $perms &= ~FILE_ATTRIB; $perms |= DIRECTORY_ATTRIB; } else { $perms &= ~DIRECTORY_ATTRIB; $perms |= FILE_ATTRIB; } $self->{externalFileAttributes} = $self->_mapPermissionsFromUnix($perms); } return $oldPerms; } sub localExtraField { my $self = shift; if (@_) { $self->{localExtraField} = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{field} : $_[0]; } else { return $self->{localExtraField}; } } sub cdExtraField { my $self = shift; if (@_) { $self->{cdExtraField} = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{field} : $_[0]; } else { return $self->{cdExtraField}; } } sub extraFields { my $self = shift; return $self->localExtraField() . $self->cdExtraField(); } sub fileComment { my $self = shift; if (@_) { $self->{fileComment} = ( ref( $_[0] ) eq 'HASH' ) ? pack( 'C0a*', $_[0]->{comment} ) : pack( 'C0a*', $_[0] ); } else { return $self->{fileComment}; } } sub hasDataDescriptor { my $self = shift; if (@_) { my $shouldHave = shift; if ($shouldHave) { $self->{'bitFlag'} |= GPBF_HAS_DATA_DESCRIPTOR_MASK; } else { $self->{'bitFlag'} &= ~GPBF_HAS_DATA_DESCRIPTOR_MASK; } } return $self->{'bitFlag'} & GPBF_HAS_DATA_DESCRIPTOR_MASK; } sub crc32 { shift->{'crc32'}; } sub crc32String { sprintf( "%08x", shift->{'crc32'} ); } sub compressedSize { shift->{'compressedSize'}; } sub uncompressedSize { shift->{'uncompressedSize'}; } sub isEncrypted { shift->bitFlag() & GPBF_ENCRYPTED_MASK; } sub isTextFile { my $self = shift; my $bit = $self->internalFileAttributes() & IFA_TEXT_FILE_MASK; if (@_) { my $flag = ( ref( $_[0] ) eq 'HASH' ) ? shift->{flag} : shift; $self->{'internalFileAttributes'} &= ~IFA_TEXT_FILE_MASK; $self->{'internalFileAttributes'} |= ( $flag ? IFA_TEXT_FILE: IFA_BINARY_FILE ); } return $bit == IFA_TEXT_FILE; } sub isBinaryFile { my $self = shift; my $bit = $self->internalFileAttributes() & IFA_TEXT_FILE_MASK; if (@_) { my $flag = shift; $self->{'internalFileAttributes'} &= ~IFA_TEXT_FILE_MASK; $self->{'internalFileAttributes'} |= ( $flag ? IFA_BINARY_FILE: IFA_TEXT_FILE ); } return $bit == IFA_BINARY_FILE; } sub extractToFileNamed { my $self = shift; # local FS name my $name = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{name} : $_[0]; $self->{'isSymbolicLink'} = 0; # Check if the file / directory is a symbolic link or not if ( $self->{'externalFileAttributes'} == 0xA1FF0000 ) { $self->{'isSymbolicLink'} = 1; $self->{'newName'} = $name; my ( $status, $fh ) = _newFileHandle( $name, 'r' ); my $retval = $self->extractToFileHandle($fh); $fh->close(); } else { #return _writeSymbolicLink($self, $name) if $self->isSymbolicLink(); return _error("encryption unsupported") if $self->isEncrypted(); mkpath( dirname($name) ); # croaks on error my ( $status, $fh ) = _newFileHandle( $name, 'w' ); return _ioError("Can't open file $name for write") unless $status; my $retval = $self->extractToFileHandle($fh); $fh->close(); chmod ($self->unixFileAttributes(), $name) or return _error("Can't chmod() ${name}: $!"); utime( $self->lastModTime(), $self->lastModTime(), $name ); return $retval; } } sub _writeSymbolicLink { my $self = shift; my $name = shift; my $chunkSize = $Archive::Zip::ChunkSize; #my ( $outRef, undef ) = $self->readChunk($chunkSize); my $fh; my $retval = $self->extractToFileHandle($fh); my ( $outRef, undef ) = $self->readChunk(100); } sub isSymbolicLink { my $self = shift; if ( $self->{'externalFileAttributes'} == 0xA1FF0000 ) { $self->{'isSymbolicLink'} = 1; } else { return 0; } 1; } sub isDirectory { return 0; } sub externalFileName { return undef; } # The following are used when copying data sub _writeOffset { shift->{'writeOffset'}; } sub _readOffset { shift->{'readOffset'}; } sub writeLocalHeaderRelativeOffset { shift->{'writeLocalHeaderRelativeOffset'}; } sub wasWritten { shift->{'wasWritten'} } sub _dataEnded { shift->{'dataEnded'}; } sub _readDataRemaining { shift->{'readDataRemaining'}; } sub _inflater { shift->{'inflater'}; } sub _deflater { shift->{'deflater'}; } # Return the total size of my local header sub _localHeaderSize { my $self = shift; return SIGNATURE_LENGTH + LOCAL_FILE_HEADER_LENGTH + length( $self->fileName() ) + length( $self->localExtraField() ); } # Return the total size of my CD header sub _centralDirectoryHeaderSize { my $self = shift; return SIGNATURE_LENGTH + CENTRAL_DIRECTORY_FILE_HEADER_LENGTH + length( $self->fileName() ) + length( $self->cdExtraField() ) + length( $self->fileComment() ); } # DOS date/time format # 0-4 (5) Second divided by 2 # 5-10 (6) Minute (0-59) # 11-15 (5) Hour (0-23 on a 24-hour clock) # 16-20 (5) Day of the month (1-31) # 21-24 (4) Month (1 = January, 2 = February, etc.) # 25-31 (7) Year offset from 1980 (add 1980 to get actual year) # Convert DOS date/time format to unix time_t format # NOT AN OBJECT METHOD! sub _dosToUnixTime { my $dt = shift; return time() unless defined($dt); my $year = ( ( $dt >> 25 ) & 0x7f ) + 80; my $mon = ( ( $dt >> 21 ) & 0x0f ) - 1; my $mday = ( ( $dt >> 16 ) & 0x1f ); my $hour = ( ( $dt >> 11 ) & 0x1f ); my $min = ( ( $dt >> 5 ) & 0x3f ); my $sec = ( ( $dt << 1 ) & 0x3e ); # catch errors my $time_t = eval { Time::Local::timelocal( $sec, $min, $hour, $mday, $mon, $year ); }; return time() if ($@); return $time_t; } # Note, this isn't exactly UTC 1980, it's 1980 + 12 hours and 1 # minute so that nothing timezoney can muck us up. my $safe_epoch = 315576060; # convert a unix time to DOS date/time # NOT AN OBJECT METHOD! sub _unixToDosTime { my $time_t = shift; unless ($time_t) { _error("Tried to add member with zero or undef value for time"); $time_t = $safe_epoch; } if ( $time_t < $safe_epoch ) { _ioError("Unsupported date before 1980 encountered, moving to 1980"); $time_t = $safe_epoch; } my ( $sec, $min, $hour, $mday, $mon, $year ) = localtime($time_t); my $dt = 0; $dt += ( $sec >> 1 ); $dt += ( $min << 5 ); $dt += ( $hour << 11 ); $dt += ( $mday << 16 ); $dt += ( ( $mon + 1 ) << 21 ); $dt += ( ( $year - 80 ) << 25 ); return $dt; } # Write my local header to a file handle. # Stores the offset to the start of the header in my # writeLocalHeaderRelativeOffset member. # Returns AZ_OK on success. sub _writeLocalFileHeader { my $self = shift; my $fh = shift; my $signatureData = pack( SIGNATURE_FORMAT, LOCAL_FILE_HEADER_SIGNATURE ); $self->_print($fh, $signatureData) or return _ioError("writing local header signature"); my $header = pack( LOCAL_FILE_HEADER_FORMAT, $self->versionNeededToExtract(), $self->bitFlag(), $self->desiredCompressionMethod(), $self->lastModFileDateTime(), $self->crc32(), $self->compressedSize(), # may need to be re-written later $self->uncompressedSize(), length( $self->fileName() ), length( $self->localExtraField() ) ); $self->_print($fh, $header) or return _ioError("writing local header"); # Check for a valid filename or a filename equal to a literal `0' if ( $self->fileName() || $self->fileName eq '0' ) { $self->_print($fh, $self->fileName() ) or return _ioError("writing local header filename"); } if ( $self->localExtraField() ) { $self->_print($fh, $self->localExtraField() ) or return _ioError("writing local extra field"); } return AZ_OK; } sub _writeCentralDirectoryFileHeader { my $self = shift; my $fh = shift; my $sigData = pack( SIGNATURE_FORMAT, CENTRAL_DIRECTORY_FILE_HEADER_SIGNATURE ); $self->_print($fh, $sigData) or return _ioError("writing central directory header signature"); my $fileNameLength = length( $self->fileName() ); my $extraFieldLength = length( $self->cdExtraField() ); my $fileCommentLength = length( $self->fileComment() ); my $header = pack( CENTRAL_DIRECTORY_FILE_HEADER_FORMAT, $self->versionMadeBy(), $self->fileAttributeFormat(), $self->versionNeededToExtract(), $self->bitFlag(), $self->desiredCompressionMethod(), $self->lastModFileDateTime(), $self->crc32(), # these three fields should have been updated $self->_writeOffset(), # by writing the data stream out $self->uncompressedSize(), # $fileNameLength, $extraFieldLength, $fileCommentLength, 0, # {'diskNumberStart'}, $self->internalFileAttributes(), $self->externalFileAttributes(), $self->writeLocalHeaderRelativeOffset() ); $self->_print($fh, $header) or return _ioError("writing central directory header"); if ($fileNameLength) { $self->_print($fh, $self->fileName() ) or return _ioError("writing central directory header signature"); } if ($extraFieldLength) { $self->_print($fh, $self->cdExtraField() ) or return _ioError("writing central directory extra field"); } if ($fileCommentLength) { $self->_print($fh, $self->fileComment() ) or return _ioError("writing central directory file comment"); } return AZ_OK; } # This writes a data descriptor to the given file handle. # Assumes that crc32, writeOffset, and uncompressedSize are # set correctly (they should be after a write). # Further, the local file header should have the # GPBF_HAS_DATA_DESCRIPTOR_MASK bit set. sub _writeDataDescriptor { my $self = shift; my $fh = shift; my $header = pack( SIGNATURE_FORMAT . DATA_DESCRIPTOR_FORMAT, DATA_DESCRIPTOR_SIGNATURE, $self->crc32(), $self->_writeOffset(), # compressed size $self->uncompressedSize() ); $self->_print($fh, $header) or return _ioError("writing data descriptor"); return AZ_OK; } # Re-writes the local file header with new crc32 and compressedSize fields. # To be called after writing the data stream. # Assumes that filename and extraField sizes didn't change since last written. sub _refreshLocalFileHeader { my $self = shift; my $fh = shift; my $here = $fh->tell(); $fh->seek( $self->writeLocalHeaderRelativeOffset() + SIGNATURE_LENGTH, IO::Seekable::SEEK_SET ) or return _ioError("seeking to rewrite local header"); my $header = pack( LOCAL_FILE_HEADER_FORMAT, $self->versionNeededToExtract(), $self->bitFlag(), $self->desiredCompressionMethod(), $self->lastModFileDateTime(), $self->crc32(), $self->_writeOffset(), # compressed size $self->uncompressedSize(), length( $self->fileName() ), length( $self->localExtraField() ) ); $self->_print($fh, $header) or return _ioError("re-writing local header"); $fh->seek( $here, IO::Seekable::SEEK_SET ) or return _ioError("seeking after rewrite of local header"); return AZ_OK; } sub readChunk { my $self = shift; my $chunkSize = ( ref( $_[0] ) eq 'HASH' ) ? $_[0]->{chunkSize} : $_[0]; if ( $self->readIsDone() ) { $self->endRead(); my $dummy = ''; return ( \$dummy, AZ_STREAM_END ); } $chunkSize = $Archive::Zip::ChunkSize if not defined($chunkSize); $chunkSize = $self->_readDataRemaining() if $chunkSize > $self->_readDataRemaining(); my $buffer = ''; my $outputRef; my ( $bytesRead, $status ) = $self->_readRawChunk( \$buffer, $chunkSize ); return ( \$buffer, $status ) unless $status == AZ_OK; $self->{'readDataRemaining'} -= $bytesRead; $self->{'readOffset'} += $bytesRead; if ( $self->compressionMethod() == COMPRESSION_STORED ) { $self->{'crc32'} = $self->computeCRC32( $buffer, $self->{'crc32'} ); } ( $outputRef, $status ) = &{ $self->{'chunkHandler'} }( $self, \$buffer ); $self->{'writeOffset'} += length($$outputRef); $self->endRead() if $self->readIsDone(); return ( $outputRef, $status ); } # Read the next raw chunk of my data. Subclasses MUST implement. # my ( $bytesRead, $status) = $self->_readRawChunk( \$buffer, $chunkSize ); sub _readRawChunk { my $self = shift; return $self->_subclassResponsibility(); } # A place holder to catch rewindData errors if someone ignores # the error code. sub _noChunk { my $self = shift; return ( \undef, _error("trying to copy chunk when init failed") ); } # Basically a no-op so that I can have a consistent interface. # ( $outputRef, $status) = $self->_copyChunk( \$buffer ); sub _copyChunk { my ( $self, $dataRef ) = @_; return ( $dataRef, AZ_OK ); } # ( $outputRef, $status) = $self->_deflateChunk( \$buffer ); sub _deflateChunk { my ( $self, $buffer ) = @_; my ( $status ) = $self->_deflater()->deflate( $buffer, my $out ); if ( $self->_readDataRemaining() == 0 ) { my $extraOutput; ( $status ) = $self->_deflater()->flush($extraOutput); $out .= $extraOutput; $self->endRead(); return ( \$out, AZ_STREAM_END ); } elsif ( $status == Z_OK ) { return ( \$out, AZ_OK ); } else { $self->endRead(); my $retval = _error( 'deflate error', $status ); my $dummy = ''; return ( \$dummy, $retval ); } } # ( $outputRef, $status) = $self->_inflateChunk( \$buffer ); sub _inflateChunk { my ( $self, $buffer ) = @_; my ( $status ) = $self->_inflater()->inflate( $buffer, my $out ); my $retval; $self->endRead() unless $status == Z_OK; if ( $status == Z_OK || $status == Z_STREAM_END ) { $retval = ( $status == Z_STREAM_END ) ? AZ_STREAM_END: AZ_OK; return ( \$out, $retval ); } else { $retval = _error( 'inflate error', $status ); my $dummy = ''; return ( \$dummy, $retval ); } } sub rewindData { my $self = shift; my $status; # set to trap init errors $self->{'chunkHandler'} = $self->can('_noChunk'); # Work around WinZip bug with 0-length DEFLATED files $self->desiredCompressionMethod(COMPRESSION_STORED) if $self->uncompressedSize() == 0; # assume that we're going to read the whole file, and compute the CRC anew. $self->{'crc32'} = 0 if ( $self->compressionMethod() == COMPRESSION_STORED ); # These are the only combinations of methods we deal with right now. if ( $self->compressionMethod() == COMPRESSION_STORED and $self->desiredCompressionMethod() == COMPRESSION_DEFLATED ) { ( $self->{'deflater'}, $status ) = Compress::Raw::Zlib::Deflate->new( '-Level' => $self->desiredCompressionLevel(), '-WindowBits' => -MAX_WBITS(), # necessary magic '-Bufsize' => $Archive::Zip::ChunkSize, @_ ); # pass additional options return _error( 'deflateInit error:', $status ) unless $status == Z_OK; $self->{'chunkHandler'} = $self->can('_deflateChunk'); } elsif ( $self->compressionMethod() == COMPRESSION_DEFLATED and $self->desiredCompressionMethod() == COMPRESSION_STORED ) { ( $self->{'inflater'}, $status ) = Compress::Raw::Zlib::Inflate->new( '-WindowBits' => -MAX_WBITS(), # necessary magic '-Bufsize' => $Archive::Zip::ChunkSize, @_ ); # pass additional options return _error( 'inflateInit error:', $status ) unless $status == Z_OK; $self->{'chunkHandler'} = $self->can('_inflateChunk'); } elsif ( $self->compressionMethod() == $self->desiredCompressionMethod() ) { $self->{'chunkHandler'} = $self->can('_copyChunk'); } else { return _error( sprintf( "Unsupported compression combination: read %d, write %d", $self->compressionMethod(), $self->desiredCompressionMethod() ) ); } $self->{'readDataRemaining'} = ( $self->compressionMethod() == COMPRESSION_STORED ) ? $self->uncompressedSize() : $self->compressedSize(); $self->{'dataEnded'} = 0; $self->{'readOffset'} = 0; return AZ_OK; } sub endRead { my $self = shift; delete $self->{'inflater'}; delete $self->{'deflater'}; $self->{'dataEnded'} = 1; $self->{'readDataRemaining'} = 0; return AZ_OK; } sub readIsDone { my $self = shift; return ( $self->_dataEnded() or !$self->_readDataRemaining() ); } sub contents { my $self = shift; my $newContents = shift; if ( defined($newContents) ) { # change our type and call the subclass contents method. $self->_become(STRINGMEMBERCLASS); return $self->contents( pack( 'C0a*', $newContents ) ) ; # in case of Unicode } else { my $oldCompression = $self->desiredCompressionMethod(COMPRESSION_STORED); my $status = $self->rewindData(@_); if ( $status != AZ_OK ) { $self->endRead(); return $status; } my $retval = ''; while ( $status == AZ_OK ) { my $ref; ( $ref, $status ) = $self->readChunk( $self->_readDataRemaining() ); # did we get it in one chunk? if ( length($$ref) == $self->uncompressedSize() ) { $retval = $$ref; } else { $retval .= $$ref } } $self->desiredCompressionMethod($oldCompression); $self->endRead(); $status = AZ_OK if $status == AZ_STREAM_END; $retval = undef unless $status == AZ_OK; return wantarray ? ( $retval, $status ) : $retval; } } sub extractToFileHandle { my $self = shift; return _error("encryption unsupported") if $self->isEncrypted(); my $fh = ( ref( $_[0] ) eq 'HASH' ) ? shift->{fileHandle} : shift; _binmode($fh); my $oldCompression = $self->desiredCompressionMethod(COMPRESSION_STORED); my $status = $self->rewindData(@_); $status = $self->_writeData($fh) if $status == AZ_OK; $self->desiredCompressionMethod($oldCompression); $self->endRead(); return $status; } # write local header and data stream to file handle sub _writeToFileHandle { my $self = shift; my $fh = shift; my $fhIsSeekable = shift; my $offset = shift; return _error("no member name given for $self") if $self->fileName() eq ''; $self->{'writeLocalHeaderRelativeOffset'} = $offset; $self->{'wasWritten'} = 0; # Determine if I need to write a data descriptor # I need to do this if I can't refresh the header # and I don't know compressed size or crc32 fields. my $headerFieldsUnknown = ( ( $self->uncompressedSize() > 0 ) and ($self->compressionMethod() == COMPRESSION_STORED or $self->desiredCompressionMethod() == COMPRESSION_DEFLATED ) ); my $shouldWriteDataDescriptor = ( $headerFieldsUnknown and not $fhIsSeekable ); $self->hasDataDescriptor(1) if ($shouldWriteDataDescriptor); $self->{'writeOffset'} = 0; my $status = $self->rewindData(); ( $status = $self->_writeLocalFileHeader($fh) ) if $status == AZ_OK; ( $status = $self->_writeData($fh) ) if $status == AZ_OK; if ( $status == AZ_OK ) { $self->{'wasWritten'} = 1; if ( $self->hasDataDescriptor() ) { $status = $self->_writeDataDescriptor($fh); } elsif ($headerFieldsUnknown) { $status = $self->_refreshLocalFileHeader($fh); } } return $status; } # Copy my (possibly compressed) data to given file handle. # Returns C on success sub _writeData { my $self = shift; my $writeFh = shift; # If symbolic link, just create one if the operating system is Linux, Unix, BSD or VMS # TODO: Add checks for other operating systems if ( $self->{'isSymbolicLink'} == 1 && $^O eq 'linux' ) { my $chunkSize = $Archive::Zip::ChunkSize; my ( $outRef, $status ) = $self->readChunk($chunkSize); symlink $$outRef, $self->{'newName'}; } else { return AZ_OK if ( $self->uncompressedSize() == 0 ); my $status; my $chunkSize = $Archive::Zip::ChunkSize; while ( $self->_readDataRemaining() > 0 ) { my $outRef; ( $outRef, $status ) = $self->readChunk($chunkSize); return $status if ( $status != AZ_OK and $status != AZ_STREAM_END ); if ( length($$outRef) > 0 ) { $self->_print($writeFh, $$outRef) or return _ioError("write error during copy"); } last if $status == AZ_STREAM_END; } $self->{'compressedSize'} = $self->_writeOffset(); } return AZ_OK; } # Return true if I depend on the named file sub _usesFileNamed { return 0; } 1; FILE%c6676318/Archive/Zip/NewFileMember.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/NewFileMember.pm" package Archive::Zip::NewFileMember; use strict; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw ( Archive::Zip::FileMember ); } use Archive::Zip qw( :CONSTANTS :ERROR_CODES :UTILITY_METHODS ); # Given a file name, set up for eventual writing. sub _newFromFileNamed { my $class = shift; my $fileName = shift; # local FS format my $newName = shift; $newName = _asZipDirName($fileName) unless defined($newName); return undef unless ( stat($fileName) && -r _ && !-d _ ); my $self = $class->new(@_); $self->{'fileName'} = $newName; $self->{'externalFileName'} = $fileName; $self->{'compressionMethod'} = COMPRESSION_STORED; my @stat = stat(_); $self->{'compressedSize'} = $self->{'uncompressedSize'} = $stat[7]; $self->desiredCompressionMethod( ( $self->compressedSize() > 0 ) ? COMPRESSION_DEFLATED : COMPRESSION_STORED ); $self->unixFileAttributes( $stat[2] ); $self->setLastModFileDateTimeFromUnix( $stat[9] ); $self->isTextFile( -T _ ); return $self; } sub rewindData { my $self = shift; my $status = $self->SUPER::rewindData(@_); return $status unless $status == AZ_OK; return AZ_IO_ERROR unless $self->fh(); $self->fh()->clearerr(); $self->fh()->seek( 0, IO::Seekable::SEEK_SET ) or return _ioError( "rewinding", $self->externalFileName() ); return AZ_OK; } # Return bytes read. Note that first parameter is a ref to a buffer. # my $data; # my ( $bytesRead, $status) = $self->readRawChunk( \$data, $chunkSize ); sub _readRawChunk { my ( $self, $dataRef, $chunkSize ) = @_; return ( 0, AZ_OK ) unless $chunkSize; my $bytesRead = $self->fh()->read( $$dataRef, $chunkSize ) or return ( 0, _ioError("reading data") ); return ( $bytesRead, AZ_OK ); } # If I already exist, extraction is a no-op. sub extractToFileNamed { my $self = shift; my $name = shift; # local FS name if ( File::Spec->rel2abs($name) eq File::Spec->rel2abs( $self->externalFileName() ) and -r $name ) { return AZ_OK; } else { return $self->SUPER::extractToFileNamed( $name, @_ ); } } 1; FILE$8fe1b4b8/Archive/Zip/StringMember.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/StringMember.pm" package Archive::Zip::StringMember; use strict; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw( Archive::Zip::Member ); } use Archive::Zip qw( :CONSTANTS :ERROR_CODES ); # Create a new string member. Default is COMPRESSION_STORED. # Can take a ref to a string as well. sub _newFromString { my $class = shift; my $string = shift; my $name = shift; my $self = $class->new(@_); $self->contents($string); $self->fileName($name) if defined($name); # Set the file date to now $self->setLastModFileDateTimeFromUnix( time() ); $self->unixFileAttributes( $self->DEFAULT_FILE_PERMISSIONS ); return $self; } sub _become { my $self = shift; my $newClass = shift; return $self if ref($self) eq $newClass; delete( $self->{'contents'} ); return $self->SUPER::_become($newClass); } # Get or set my contents. Note that we do not call the superclass # version of this, because it calls us. sub contents { my $self = shift; my $string = shift; if ( defined($string) ) { $self->{'contents'} = pack( 'C0a*', ( ref($string) eq 'SCALAR' ) ? $$string : $string ); $self->{'uncompressedSize'} = $self->{'compressedSize'} = length( $self->{'contents'} ); $self->{'compressionMethod'} = COMPRESSION_STORED; } return $self->{'contents'}; } # Return bytes read. Note that first parameter is a ref to a buffer. # my $data; # my ( $bytesRead, $status) = $self->readRawChunk( \$data, $chunkSize ); sub _readRawChunk { my ( $self, $dataRef, $chunkSize ) = @_; $$dataRef = substr( $self->contents(), $self->_readOffset(), $chunkSize ); return ( length($$dataRef), AZ_OK ); } 1; FILE%54a6668b/Archive/Zip/ZipFileMember.pm5$#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/Archive/Zip/ZipFileMember.pm" package Archive::Zip::ZipFileMember; use strict; use vars qw( $VERSION @ISA ); BEGIN { $VERSION = '1.30'; @ISA = qw ( Archive::Zip::FileMember ); } use Archive::Zip qw( :CONSTANTS :ERROR_CODES :PKZIP_CONSTANTS :UTILITY_METHODS ); # Create a new Archive::Zip::ZipFileMember # given a filename and optional open file handle # sub _newFromZipFile { my $class = shift; my $fh = shift; my $externalFileName = shift; my $possibleEocdOffset = shift; # normally 0 my $self = $class->new( 'crc32' => 0, 'diskNumberStart' => 0, 'localHeaderRelativeOffset' => 0, 'dataOffset' => 0, # localHeaderRelativeOffset + header length @_ ); $self->{'externalFileName'} = $externalFileName; $self->{'fh'} = $fh; $self->{'possibleEocdOffset'} = $possibleEocdOffset; return $self; } sub isDirectory { my $self = shift; return ( substr( $self->fileName, -1, 1 ) eq '/' and $self->uncompressedSize == 0 ); } # Seek to the beginning of the local header, just past the signature. # Verify that the local header signature is in fact correct. # Update the localHeaderRelativeOffset if necessary by adding the possibleEocdOffset. # Returns status. sub _seekToLocalHeader { my $self = shift; my $where = shift; # optional my $previousWhere = shift; # optional $where = $self->localHeaderRelativeOffset() unless defined($where); # avoid loop on certain corrupt files (from Julian Field) return _formatError("corrupt zip file") if defined($previousWhere) && $where == $previousWhere; my $status; my $signature; $status = $self->fh()->seek( $where, IO::Seekable::SEEK_SET ); return _ioError("seeking to local header") unless $status; ( $status, $signature ) = _readSignature( $self->fh(), $self->externalFileName(), LOCAL_FILE_HEADER_SIGNATURE ); return $status if $status == AZ_IO_ERROR; # retry with EOCD offset if any was given. if ( $status == AZ_FORMAT_ERROR && $self->{'possibleEocdOffset'} ) { $status = $self->_seekToLocalHeader( $self->localHeaderRelativeOffset() + $self->{'possibleEocdOffset'}, $where ); if ( $status == AZ_OK ) { $self->{'localHeaderRelativeOffset'} += $self->{'possibleEocdOffset'}; $self->{'possibleEocdOffset'} = 0; } } return $status; } # Because I'm going to delete the file handle, read the local file # header if the file handle is seekable. If it isn't, I assume that # I've already read the local header. # Return ( $status, $self ) sub _become { my $self = shift; my $newClass = shift; return $self if ref($self) eq $newClass; my $status = AZ_OK; if ( _isSeekable( $self->fh() ) ) { my $here = $self->fh()->tell(); $status = $self->_seekToLocalHeader(); $status = $self->_readLocalFileHeader() if $status == AZ_OK; $self->fh()->seek( $here, IO::Seekable::SEEK_SET ); return $status unless $status == AZ_OK; } delete( $self->{'eocdCrc32'} ); delete( $self->{'diskNumberStart'} ); delete( $self->{'localHeaderRelativeOffset'} ); delete( $self->{'dataOffset'} ); return $self->SUPER::_become($newClass); } sub diskNumberStart { shift->{'diskNumberStart'}; } sub localHeaderRelativeOffset { shift->{'localHeaderRelativeOffset'}; } sub dataOffset { shift->{'dataOffset'}; } # Skip local file header, updating only extra field stuff. # Assumes that fh is positioned before signature. sub _skipLocalFileHeader { my $self = shift; my $header; my $bytesRead = $self->fh()->read( $header, LOCAL_FILE_HEADER_LENGTH ); if ( $bytesRead != LOCAL_FILE_HEADER_LENGTH ) { return _ioError("reading local file header"); } my $fileNameLength; my $extraFieldLength; my $bitFlag; ( undef, # $self->{'versionNeededToExtract'}, $bitFlag, undef, # $self->{'compressionMethod'}, undef, # $self->{'lastModFileDateTime'}, undef, # $crc32, undef, # $compressedSize, undef, # $uncompressedSize, $fileNameLength, $extraFieldLength ) = unpack( LOCAL_FILE_HEADER_FORMAT, $header ); if ($fileNameLength) { $self->fh()->seek( $fileNameLength, IO::Seekable::SEEK_CUR ) or return _ioError("skipping local file name"); } if ($extraFieldLength) { $bytesRead = $self->fh()->read( $self->{'localExtraField'}, $extraFieldLength ); if ( $bytesRead != $extraFieldLength ) { return _ioError("reading local extra field"); } } $self->{'dataOffset'} = $self->fh()->tell(); if ( $bitFlag & GPBF_HAS_DATA_DESCRIPTOR_MASK ) { # Read the crc32, compressedSize, and uncompressedSize from the # extended data descriptor, which directly follows the compressed data. # # Skip over the compressed file data (assumes that EOCD compressedSize # was correct) $self->fh()->seek( $self->{'compressedSize'}, IO::Seekable::SEEK_CUR ) or return _ioError("seeking to extended local header"); # these values should be set correctly from before. my $oldCrc32 = $self->{'eocdCrc32'}; my $oldCompressedSize = $self->{'compressedSize'}; my $oldUncompressedSize = $self->{'uncompressedSize'}; my $status = $self->_readDataDescriptor(); return $status unless $status == AZ_OK; return _formatError( "CRC or size mismatch while skipping data descriptor") if ( $oldCrc32 != $self->{'crc32'} || $oldUncompressedSize != $self->{'uncompressedSize'} ); } return AZ_OK; } # Read from a local file header into myself. Returns AZ_OK if successful. # Assumes that fh is positioned after signature. # Note that crc32, compressedSize, and uncompressedSize will be 0 if # GPBF_HAS_DATA_DESCRIPTOR_MASK is set in the bitFlag. sub _readLocalFileHeader { my $self = shift; my $header; my $bytesRead = $self->fh()->read( $header, LOCAL_FILE_HEADER_LENGTH ); if ( $bytesRead != LOCAL_FILE_HEADER_LENGTH ) { return _ioError("reading local file header"); } my $fileNameLength; my $crc32; my $compressedSize; my $uncompressedSize; my $extraFieldLength; ( $self->{'versionNeededToExtract'}, $self->{'bitFlag'}, $self->{'compressionMethod'}, $self->{'lastModFileDateTime'}, $crc32, $compressedSize, $uncompressedSize, $fileNameLength, $extraFieldLength ) = unpack( LOCAL_FILE_HEADER_FORMAT, $header ); if ($fileNameLength) { my $fileName; $bytesRead = $self->fh()->read( $fileName, $fileNameLength ); if ( $bytesRead != $fileNameLength ) { return _ioError("reading local file name"); } $self->fileName($fileName); } if ($extraFieldLength) { $bytesRead = $self->fh()->read( $self->{'localExtraField'}, $extraFieldLength ); if ( $bytesRead != $extraFieldLength ) { return _ioError("reading local extra field"); } } $self->{'dataOffset'} = $self->fh()->tell(); if ( $self->hasDataDescriptor() ) { # Read the crc32, compressedSize, and uncompressedSize from the # extended data descriptor. # Skip over the compressed file data (assumes that EOCD compressedSize # was correct) $self->fh()->seek( $self->{'compressedSize'}, IO::Seekable::SEEK_CUR ) or return _ioError("seeking to extended local header"); my $status = $self->_readDataDescriptor(); return $status unless $status == AZ_OK; } else { return _formatError( "CRC or size mismatch after reading data descriptor") if ( $self->{'crc32'} != $crc32 || $self->{'uncompressedSize'} != $uncompressedSize ); } return AZ_OK; } # This will read the data descriptor, which is after the end of compressed file # data in members that that have GPBF_HAS_DATA_DESCRIPTOR_MASK set in their # bitFlag. # The only reliable way to find these is to rely on the EOCD compressedSize. # Assumes that file is positioned immediately after the compressed data. # Returns status; sets crc32, compressedSize, and uncompressedSize. sub _readDataDescriptor { my $self = shift; my $signatureData; my $header; my $crc32; my $compressedSize; my $uncompressedSize; my $bytesRead = $self->fh()->read( $signatureData, SIGNATURE_LENGTH ); return _ioError("reading header signature") if $bytesRead != SIGNATURE_LENGTH; my $signature = unpack( SIGNATURE_FORMAT, $signatureData ); # unfortunately, the signature appears to be optional. if ( $signature == DATA_DESCRIPTOR_SIGNATURE && ( $signature != $self->{'crc32'} ) ) { $bytesRead = $self->fh()->read( $header, DATA_DESCRIPTOR_LENGTH ); return _ioError("reading data descriptor") if $bytesRead != DATA_DESCRIPTOR_LENGTH; ( $crc32, $compressedSize, $uncompressedSize ) = unpack( DATA_DESCRIPTOR_FORMAT, $header ); } else { $bytesRead = $self->fh()->read( $header, DATA_DESCRIPTOR_LENGTH_NO_SIG ); return _ioError("reading data descriptor") if $bytesRead != DATA_DESCRIPTOR_LENGTH_NO_SIG; $crc32 = $signature; ( $compressedSize, $uncompressedSize ) = unpack( DATA_DESCRIPTOR_FORMAT_NO_SIG, $header ); } $self->{'eocdCrc32'} = $self->{'crc32'} unless defined( $self->{'eocdCrc32'} ); $self->{'crc32'} = $crc32; $self->{'compressedSize'} = $compressedSize; $self->{'uncompressedSize'} = $uncompressedSize; return AZ_OK; } # Read a Central Directory header. Return AZ_OK on success. # Assumes that fh is positioned right after the signature. sub _readCentralDirectoryFileHeader { my $self = shift; my $fh = $self->fh(); my $header = ''; my $bytesRead = $fh->read( $header, CENTRAL_DIRECTORY_FILE_HEADER_LENGTH ); if ( $bytesRead != CENTRAL_DIRECTORY_FILE_HEADER_LENGTH ) { return _ioError("reading central dir header"); } my ( $fileNameLength, $extraFieldLength, $fileCommentLength ); ( $self->{'versionMadeBy'}, $self->{'fileAttributeFormat'}, $self->{'versionNeededToExtract'}, $self->{'bitFlag'}, $self->{'compressionMethod'}, $self->{'lastModFileDateTime'}, $self->{'crc32'}, $self->{'compressedSize'}, $self->{'uncompressedSize'}, $fileNameLength, $extraFieldLength, $fileCommentLength, $self->{'diskNumberStart'}, $self->{'internalFileAttributes'}, $self->{'externalFileAttributes'}, $self->{'localHeaderRelativeOffset'} ) = unpack( CENTRAL_DIRECTORY_FILE_HEADER_FORMAT, $header ); $self->{'eocdCrc32'} = $self->{'crc32'}; if ($fileNameLength) { $bytesRead = $fh->read( $self->{'fileName'}, $fileNameLength ); if ( $bytesRead != $fileNameLength ) { _ioError("reading central dir filename"); } } if ($extraFieldLength) { $bytesRead = $fh->read( $self->{'cdExtraField'}, $extraFieldLength ); if ( $bytesRead != $extraFieldLength ) { return _ioError("reading central dir extra field"); } } if ($fileCommentLength) { $bytesRead = $fh->read( $self->{'fileComment'}, $fileCommentLength ); if ( $bytesRead != $fileCommentLength ) { return _ioError("reading central dir file comment"); } } # NK 10/21/04: added to avoid problems with manipulated headers if ( $self->{'uncompressedSize'} != $self->{'compressedSize'} and $self->{'compressionMethod'} == COMPRESSION_STORED ) { $self->{'uncompressedSize'} = $self->{'compressedSize'}; } $self->desiredCompressionMethod( $self->compressionMethod() ); return AZ_OK; } sub rewindData { my $self = shift; my $status = $self->SUPER::rewindData(@_); return $status unless $status == AZ_OK; return AZ_IO_ERROR unless $self->fh(); $self->fh()->clearerr(); # Seek to local file header. # The only reason that I'm doing this this way is that the extraField # length seems to be different between the CD header and the LF header. $status = $self->_seekToLocalHeader(); return $status unless $status == AZ_OK; # skip local file header $status = $self->_skipLocalFileHeader(); return $status unless $status == AZ_OK; # Seek to beginning of file data $self->fh()->seek( $self->dataOffset(), IO::Seekable::SEEK_SET ) or return _ioError("seeking to beginning of file data"); return AZ_OK; } # Return bytes read. Note that first parameter is a ref to a buffer. # my $data; # my ( $bytesRead, $status) = $self->readRawChunk( \$data, $chunkSize ); sub _readRawChunk { my ( $self, $dataRef, $chunkSize ) = @_; return ( 0, AZ_OK ) unless $chunkSize; my $bytesRead = $self->fh()->read( $$dataRef, $chunkSize ) or return ( 0, _ioError("reading data") ); return ( $bytesRead, AZ_OK ); } 1; FILE592181b9/Cwd.pmB#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/i686-linux/Cwd.pm" package Cwd; #line 169 use strict; use Exporter; use vars qw(@ISA @EXPORT @EXPORT_OK $VERSION); $VERSION = '3.31'; my $xs_version = $VERSION; $VERSION = eval $VERSION; @ISA = qw/ Exporter /; @EXPORT = qw(cwd getcwd fastcwd fastgetcwd); push @EXPORT, qw(getdcwd) if $^O eq 'MSWin32'; @EXPORT_OK = qw(chdir abs_path fast_abs_path realpath fast_realpath); # sys_cwd may keep the builtin command # All the functionality of this module may provided by builtins, # there is no sense to process the rest of the file. # The best choice may be to have this in BEGIN, but how to return from BEGIN? if ($^O eq 'os2') { local $^W = 0; *cwd = defined &sys_cwd ? \&sys_cwd : \&_os2_cwd; *getcwd = \&cwd; *fastgetcwd = \&cwd; *fastcwd = \&cwd; *fast_abs_path = \&sys_abspath if defined &sys_abspath; *abs_path = \&fast_abs_path; *realpath = \&fast_abs_path; *fast_realpath = \&fast_abs_path; return 1; } # Need to look up the feature settings on VMS. The preferred way is to use the # VMS::Feature module, but that may not be available to dual life modules. my $use_vms_feature; BEGIN { if ($^O eq 'VMS') { if (eval { local $SIG{__DIE__}; require VMS::Feature; }) { $use_vms_feature = 1; } } } # Need to look up the UNIX report mode. This may become a dynamic mode # in the future. sub _vms_unix_rpt { my $unix_rpt; if ($use_vms_feature) { $unix_rpt = VMS::Feature::current("filename_unix_report"); } else { my $env_unix_rpt = $ENV{'DECC$FILENAME_UNIX_REPORT'} || ''; $unix_rpt = $env_unix_rpt =~ /^[ET1]/i; } return $unix_rpt; } # Need to look up the EFS character set mode. This may become a dynamic # mode in the future. sub _vms_efs { my $efs; if ($use_vms_feature) { $efs = VMS::Feature::current("efs_charset"); } else { my $env_efs = $ENV{'DECC$EFS_CHARSET'} || ''; $efs = $env_efs =~ /^[ET1]/i; } return $efs; } # If loading the XS stuff doesn't work, we can fall back to pure perl eval { if ( $] >= 5.006 ) { require XSLoader; XSLoader::load( __PACKAGE__, $xs_version); } else { require DynaLoader; push @ISA, 'DynaLoader'; __PACKAGE__->bootstrap( $xs_version ); } }; # Must be after the DynaLoader stuff: $VERSION = eval $VERSION; # Big nasty table of function aliases my %METHOD_MAP = ( VMS => { cwd => '_vms_cwd', getcwd => '_vms_cwd', fastcwd => '_vms_cwd', fastgetcwd => '_vms_cwd', abs_path => '_vms_abs_path', fast_abs_path => '_vms_abs_path', }, MSWin32 => { # We assume that &_NT_cwd is defined as an XSUB or in the core. cwd => '_NT_cwd', getcwd => '_NT_cwd', fastcwd => '_NT_cwd', fastgetcwd => '_NT_cwd', abs_path => 'fast_abs_path', realpath => 'fast_abs_path', }, dos => { cwd => '_dos_cwd', getcwd => '_dos_cwd', fastgetcwd => '_dos_cwd', fastcwd => '_dos_cwd', abs_path => 'fast_abs_path', }, # QNX4. QNX6 has a $os of 'nto'. qnx => { cwd => '_qnx_cwd', getcwd => '_qnx_cwd', fastgetcwd => '_qnx_cwd', fastcwd => '_qnx_cwd', abs_path => '_qnx_abs_path', fast_abs_path => '_qnx_abs_path', }, cygwin => { getcwd => 'cwd', fastgetcwd => 'cwd', fastcwd => 'cwd', abs_path => 'fast_abs_path', realpath => 'fast_abs_path', }, epoc => { cwd => '_epoc_cwd', getcwd => '_epoc_cwd', fastgetcwd => '_epoc_cwd', fastcwd => '_epoc_cwd', abs_path => 'fast_abs_path', }, MacOS => { getcwd => 'cwd', fastgetcwd => 'cwd', fastcwd => 'cwd', abs_path => 'fast_abs_path', }, ); $METHOD_MAP{NT} = $METHOD_MAP{MSWin32}; # Find the pwd command in the expected locations. We assume these # are safe. This prevents _backtick_pwd() consulting $ENV{PATH} # so everything works under taint mode. my $pwd_cmd; foreach my $try ('/bin/pwd', '/usr/bin/pwd', '/QOpenSys/bin/pwd', # OS/400 PASE. ) { if( -x $try ) { $pwd_cmd = $try; last; } } my $found_pwd_cmd = defined($pwd_cmd); unless ($pwd_cmd) { # Isn't this wrong? _backtick_pwd() will fail if somenone has # pwd in their path but it is not /bin/pwd or /usr/bin/pwd? # See [perl #16774]. --jhi $pwd_cmd = 'pwd'; } # Lazy-load Carp sub _carp { require Carp; Carp::carp(@_) } sub _croak { require Carp; Carp::croak(@_) } # The 'natural and safe form' for UNIX (pwd may be setuid root) sub _backtick_pwd { # Localize %ENV entries in a way that won't create new hash keys my @localize = grep exists $ENV{$_}, qw(PATH IFS CDPATH ENV BASH_ENV); local @ENV{@localize}; my $cwd = `$pwd_cmd`; # Belt-and-suspenders in case someone said "undef $/". local $/ = "\n"; # `pwd` may fail e.g. if the disk is full chomp($cwd) if defined $cwd; $cwd; } # Since some ports may predefine cwd internally (e.g., NT) # we take care not to override an existing definition for cwd(). unless ($METHOD_MAP{$^O}{cwd} or defined &cwd) { # The pwd command is not available in some chroot(2)'ed environments my $sep = $Config::Config{path_sep} || ':'; my $os = $^O; # Protect $^O from tainting # Try again to find a pwd, this time searching the whole PATH. if (defined $ENV{PATH} and $os ne 'MSWin32') { # no pwd on Windows my @candidates = split($sep, $ENV{PATH}); while (!$found_pwd_cmd and @candidates) { my $candidate = shift @candidates; $found_pwd_cmd = 1 if -x "$candidate/pwd"; } } # MacOS has some special magic to make `pwd` work. if( $os eq 'MacOS' || $found_pwd_cmd ) { *cwd = \&_backtick_pwd; } else { *cwd = \&getcwd; } } if ($^O eq 'cygwin') { # We need to make sure cwd() is called with no args, because it's # got an arg-less prototype and will die if args are present. local $^W = 0; my $orig_cwd = \&cwd; *cwd = sub { &$orig_cwd() } } # set a reasonable (and very safe) default for fastgetcwd, in case it # isn't redefined later (20001212 rspier) *fastgetcwd = \&cwd; # A non-XS version of getcwd() - also used to bootstrap the perl build # process, when miniperl is running and no XS loading happens. sub _perl_getcwd { abs_path('.'); } # By John Bazik # # Usage: $cwd = &fastcwd; # # This is a faster version of getcwd. It's also more dangerous because # you might chdir out of a directory that you can't chdir back into. sub fastcwd_ { my($odev, $oino, $cdev, $cino, $tdev, $tino); my(@path, $path); local(*DIR); my($orig_cdev, $orig_cino) = stat('.'); ($cdev, $cino) = ($orig_cdev, $orig_cino); for (;;) { my $direntry; ($odev, $oino) = ($cdev, $cino); CORE::chdir('..') || return undef; ($cdev, $cino) = stat('.'); last if $odev == $cdev && $oino == $cino; opendir(DIR, '.') || return undef; for (;;) { $direntry = readdir(DIR); last unless defined $direntry; next if $direntry eq '.'; next if $direntry eq '..'; ($tdev, $tino) = lstat($direntry); last unless $tdev != $odev || $tino != $oino; } closedir(DIR); return undef unless defined $direntry; # should never happen unshift(@path, $direntry); } $path = '/' . join('/', @path); if ($^O eq 'apollo') { $path = "/".$path; } # At this point $path may be tainted (if tainting) and chdir would fail. # Untaint it then check that we landed where we started. $path =~ /^(.*)\z/s # untaint && CORE::chdir($1) or return undef; ($cdev, $cino) = stat('.'); die "Unstable directory path, current directory changed unexpectedly" if $cdev != $orig_cdev || $cino != $orig_cino; $path; } if (not defined &fastcwd) { *fastcwd = \&fastcwd_ } # Keeps track of current working directory in PWD environment var # Usage: # use Cwd 'chdir'; # chdir $newdir; my $chdir_init = 0; sub chdir_init { if ($ENV{'PWD'} and $^O ne 'os2' and $^O ne 'dos' and $^O ne 'MSWin32') { my($dd,$di) = stat('.'); my($pd,$pi) = stat($ENV{'PWD'}); if (!defined $dd or !defined $pd or $di != $pi or $dd != $pd) { $ENV{'PWD'} = cwd(); } } else { my $wd = cwd(); $wd = Win32::GetFullPathName($wd) if $^O eq 'MSWin32'; $ENV{'PWD'} = $wd; } # Strip an automounter prefix (where /tmp_mnt/foo/bar == /foo/bar) if ($^O ne 'MSWin32' and $ENV{'PWD'} =~ m|(/[^/]+(/[^/]+/[^/]+))(.*)|s) { my($pd,$pi) = stat($2); my($dd,$di) = stat($1); if (defined $pd and defined $dd and $di == $pi and $dd == $pd) { $ENV{'PWD'}="$2$3"; } } $chdir_init = 1; } sub chdir { my $newdir = @_ ? shift : ''; # allow for no arg (chdir to HOME dir) $newdir =~ s|///*|/|g unless $^O eq 'MSWin32'; chdir_init() unless $chdir_init; my $newpwd; if ($^O eq 'MSWin32') { # get the full path name *before* the chdir() $newpwd = Win32::GetFullPathName($newdir); } return 0 unless CORE::chdir $newdir; if ($^O eq 'VMS') { return $ENV{'PWD'} = $ENV{'DEFAULT'} } elsif ($^O eq 'MacOS') { return $ENV{'PWD'} = cwd(); } elsif ($^O eq 'MSWin32') { $ENV{'PWD'} = $newpwd; return 1; } if (ref $newdir eq 'GLOB') { # in case a file/dir handle is passed in $ENV{'PWD'} = cwd(); } elsif ($newdir =~ m#^/#s) { $ENV{'PWD'} = $newdir; } else { my @curdir = split(m#/#,$ENV{'PWD'}); @curdir = ('') unless @curdir; my $component; foreach $component (split(m#/#, $newdir)) { next if $component eq '.'; pop(@curdir),next if $component eq '..'; push(@curdir,$component); } $ENV{'PWD'} = join('/',@curdir) || '/'; } 1; } sub _perl_abs_path { my $start = @_ ? shift : '.'; my($dotdots, $cwd, @pst, @cst, $dir, @tst); unless (@cst = stat( $start )) { _carp("stat($start): $!"); return ''; } unless (-d _) { # Make sure we can be invoked on plain files, not just directories. # NOTE that this routine assumes that '/' is the only directory separator. my ($dir, $file) = $start =~ m{^(.*)/(.+)$} or return cwd() . '/' . $start; # Can't use "-l _" here, because the previous stat was a stat(), not an lstat(). if (-l $start) { my $link_target = readlink($start); die "Can't resolve link $start: $!" unless defined $link_target; require File::Spec; $link_target = $dir . '/' . $link_target unless File::Spec->file_name_is_absolute($link_target); return abs_path($link_target); } return $dir ? abs_path($dir) . "/$file" : "/$file"; } $cwd = ''; $dotdots = $start; do { $dotdots .= '/..'; @pst = @cst; local *PARENT; unless (opendir(PARENT, $dotdots)) { # probably a permissions issue. Try the native command. return File::Spec->rel2abs( $start, _backtick_pwd() ); } unless (@cst = stat($dotdots)) { _carp("stat($dotdots): $!"); closedir(PARENT); return ''; } if ($pst[0] == $cst[0] && $pst[1] == $cst[1]) { $dir = undef; } else { do { unless (defined ($dir = readdir(PARENT))) { _carp("readdir($dotdots): $!"); closedir(PARENT); return ''; } $tst[0] = $pst[0]+1 unless (@tst = lstat("$dotdots/$dir")) } while ($dir eq '.' || $dir eq '..' || $tst[0] != $pst[0] || $tst[1] != $pst[1]); } $cwd = (defined $dir ? "$dir" : "" ) . "/$cwd" ; closedir(PARENT); } while (defined $dir); chop($cwd) unless $cwd eq '/'; # drop the trailing / $cwd; } my $Curdir; sub fast_abs_path { local $ENV{PWD} = $ENV{PWD} || ''; # Guard against clobberage my $cwd = getcwd(); require File::Spec; my $path = @_ ? shift : ($Curdir ||= File::Spec->curdir); # Detaint else we'll explode in taint mode. This is safe because # we're not doing anything dangerous with it. ($path) = $path =~ /(.*)/; ($cwd) = $cwd =~ /(.*)/; unless (-e $path) { _croak("$path: No such file or directory"); } unless (-d _) { # Make sure we can be invoked on plain files, not just directories. my ($vol, $dir, $file) = File::Spec->splitpath($path); return File::Spec->catfile($cwd, $path) unless length $dir; if (-l $path) { my $link_target = readlink($path); die "Can't resolve link $path: $!" unless defined $link_target; $link_target = File::Spec->catpath($vol, $dir, $link_target) unless File::Spec->file_name_is_absolute($link_target); return fast_abs_path($link_target); } return $dir eq File::Spec->rootdir ? File::Spec->catpath($vol, $dir, $file) : fast_abs_path(File::Spec->catpath($vol, $dir, '')) . '/' . $file; } if (!CORE::chdir($path)) { _croak("Cannot chdir to $path: $!"); } my $realpath = getcwd(); if (! ((-d $cwd) && (CORE::chdir($cwd)))) { _croak("Cannot chdir back to $cwd: $!"); } $realpath; } # added function alias to follow principle of least surprise # based on previous aliasing. --tchrist 27-Jan-00 *fast_realpath = \&fast_abs_path; # --- PORTING SECTION --- # VMS: $ENV{'DEFAULT'} points to default directory at all times # 06-Mar-1996 Charles Bailey bailey@newman.upenn.edu # Note: Use of Cwd::chdir() causes the logical name PWD to be defined # in the process logical name table as the default device and directory # seen by Perl. This may not be the same as the default device # and directory seen by DCL after Perl exits, since the effects # the CRTL chdir() function persist only until Perl exits. sub _vms_cwd { return $ENV{'DEFAULT'}; } sub _vms_abs_path { return $ENV{'DEFAULT'} unless @_; my $path = shift; my $efs = _vms_efs; my $unix_rpt = _vms_unix_rpt; if (defined &VMS::Filespec::vmsrealpath) { my $path_unix = 0; my $path_vms = 0; $path_unix = 1 if ($path =~ m#(?<=\^)/#); $path_unix = 1 if ($path =~ /^\.\.?$/); $path_vms = 1 if ($path =~ m#[\[<\]]#); $path_vms = 1 if ($path =~ /^--?$/); my $unix_mode = $path_unix; if ($efs) { # In case of a tie, the Unix report mode decides. if ($path_vms == $path_unix) { $unix_mode = $unix_rpt; } else { $unix_mode = 0 if $path_vms; } } if ($unix_mode) { # Unix format return VMS::Filespec::unixrealpath($path); } # VMS format my $new_path = VMS::Filespec::vmsrealpath($path); # Perl expects directories to be in directory format $new_path = VMS::Filespec::pathify($new_path) if -d $path; return $new_path; } # Fallback to older algorithm if correct ones are not # available. if (-l $path) { my $link_target = readlink($path); die "Can't resolve link $path: $!" unless defined $link_target; return _vms_abs_path($link_target); } # may need to turn foo.dir into [.foo] my $pathified = VMS::Filespec::pathify($path); $path = $pathified if defined $pathified; return VMS::Filespec::rmsexpand($path); } sub _os2_cwd { $ENV{'PWD'} = `cmd /c cd`; chomp $ENV{'PWD'}; $ENV{'PWD'} =~ s:\\:/:g ; return $ENV{'PWD'}; } sub _win32_cwd { if (eval 'defined &DynaLoader::boot_DynaLoader') { $ENV{'PWD'} = Win32::GetCwd(); } else { # miniperl chomp($ENV{'PWD'} = `cd`); } $ENV{'PWD'} =~ s:\\:/:g ; return $ENV{'PWD'}; } *_NT_cwd = defined &Win32::GetCwd ? \&_win32_cwd : \&_os2_cwd; sub _dos_cwd { if (!defined &Dos::GetCwd) { $ENV{'PWD'} = `command /c cd`; chomp $ENV{'PWD'}; $ENV{'PWD'} =~ s:\\:/:g ; } else { $ENV{'PWD'} = Dos::GetCwd(); } return $ENV{'PWD'}; } sub _qnx_cwd { local $ENV{PATH} = ''; local $ENV{CDPATH} = ''; local $ENV{ENV} = ''; $ENV{'PWD'} = `/usr/bin/fullpath -t`; chomp $ENV{'PWD'}; return $ENV{'PWD'}; } sub _qnx_abs_path { local $ENV{PATH} = ''; local $ENV{CDPATH} = ''; local $ENV{ENV} = ''; my $path = @_ ? shift : '.'; local *REALPATH; defined( open(REALPATH, '-|') || exec '/usr/bin/fullpath', '-t', $path ) or die "Can't open /usr/bin/fullpath: $!"; my $realpath = ; close REALPATH; chomp $realpath; return $realpath; } sub _epoc_cwd { $ENV{'PWD'} = EPOC::getcwd(); return $ENV{'PWD'}; } # Now that all the base-level functions are set up, alias the # user-level functions to the right places if (exists $METHOD_MAP{$^O}) { my $map = $METHOD_MAP{$^O}; foreach my $name (keys %$map) { local $^W = 0; # assignments trigger 'subroutine redefined' warning no strict 'refs'; *{$name} = \&{$map->{$name}}; } } # In case the XS version doesn't load. *abs_path = \&_perl_abs_path unless defined &abs_path; *getcwd = \&_perl_getcwd unless defined &getcwd; # added function alias for those of us more # used to the libc function. --tchrist 27-Jan-00 *realpath = \&abs_path; 1; FILEad270643/File/Spec.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/i686-linux/File/Spec.pm" package File::Spec; use strict; use vars qw(@ISA $VERSION); $VERSION = '3.31'; $VERSION = eval $VERSION; my %module = (MacOS => 'Mac', MSWin32 => 'Win32', os2 => 'OS2', VMS => 'VMS', epoc => 'Epoc', NetWare => 'Win32', # Yes, File::Spec::Win32 works on NetWare. symbian => 'Win32', # Yes, File::Spec::Win32 works on symbian. dos => 'OS2', # Yes, File::Spec::OS2 works on DJGPP. cygwin => 'Cygwin'); my $module = $module{$^O} || 'Unix'; require "File/Spec/$module.pm"; @ISA = ("File::Spec::$module"); 1; __END__ #line 337 FILE1d4c4fc6/File/Spec/Unix.pmr#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/i686-linux/File/Spec/Unix.pm" package File::Spec::Unix; use strict; use vars qw($VERSION); $VERSION = '3.30'; $VERSION = eval $VERSION; #line 42 sub canonpath { my ($self,$path) = @_; return unless defined $path; # Handle POSIX-style node names beginning with double slash (qnx, nto) # (POSIX says: "a pathname that begins with two successive slashes # may be interpreted in an implementation-defined manner, although # more than two leading slashes shall be treated as a single slash.") my $node = ''; my $double_slashes_special = $^O eq 'qnx' || $^O eq 'nto'; if ( $double_slashes_special && ( $path =~ s{^(//[^/]+)/?\z}{}s || $path =~ s{^(//[^/]+)/}{/}s ) ) { $node = $1; } # This used to be # $path =~ s|/+|/|g unless ($^O eq 'cygwin'); # but that made tests 29, 30, 35, 46, and 213 (as of #13272) to fail # (Mainly because trailing "" directories didn't get stripped). # Why would cygwin avoid collapsing multiple slashes into one? --jhi $path =~ s|/{2,}|/|g; # xx////xx -> xx/xx $path =~ s{(?:/\.)+(?:/|\z)}{/}g; # xx/././xx -> xx/xx $path =~ s|^(?:\./)+||s unless $path eq "./"; # ./xx -> xx $path =~ s|^/(?:\.\./)+|/|; # /../../xx -> xx $path =~ s|^/\.\.$|/|; # /.. -> / $path =~ s|/\z|| unless $path eq "/"; # xx/ -> xx return "$node$path"; } #line 82 sub catdir { my $self = shift; $self->canonpath(join('/', @_, '')); # '' because need a trailing '/' } #line 95 sub catfile { my $self = shift; my $file = $self->canonpath(pop @_); return $file unless @_; my $dir = $self->catdir(@_); $dir .= "/" unless substr($dir,-1) eq "/"; return $dir.$file; } #line 110 sub curdir { '.' } #line 118 sub devnull { '/dev/null' } #line 126 sub rootdir { '/' } #line 142 my $tmpdir; sub _tmpdir { return $tmpdir if defined $tmpdir; my $self = shift; my @dirlist = @_; { no strict 'refs'; if (${"\cTAINT"}) { # Check for taint mode on perl >= 5.8.0 require Scalar::Util; @dirlist = grep { ! Scalar::Util::tainted($_) } @dirlist; } } foreach (@dirlist) { next unless defined && -d && -w _; $tmpdir = $_; last; } $tmpdir = $self->curdir unless defined $tmpdir; $tmpdir = defined $tmpdir && $self->canonpath($tmpdir); return $tmpdir; } sub tmpdir { return $tmpdir if defined $tmpdir; $tmpdir = $_[0]->_tmpdir( $ENV{TMPDIR}, "/tmp" ); } #line 175 sub updir { '..' } #line 184 sub no_upwards { my $self = shift; return grep(!/^\.{1,2}\z/s, @_); } #line 196 sub case_tolerant { 0 } #line 208 sub file_name_is_absolute { my ($self,$file) = @_; return scalar($file =~ m:^/:s); } #line 219 sub path { return () unless exists $ENV{PATH}; my @path = split(':', $ENV{PATH}); foreach (@path) { $_ = '.' if $_ eq '' } return @path; } #line 232 sub join { my $self = shift; return $self->catfile(@_); } #line 257 sub splitpath { my ($self,$path, $nofile) = @_; my ($volume,$directory,$file) = ('','',''); if ( $nofile ) { $directory = $path; } else { $path =~ m|^ ( (?: .* / (?: \.\.?\z )? )? ) ([^/]*) |xs; $directory = $1; $file = $2; } return ($volume,$directory,$file); } #line 299 sub splitdir { return split m|/|, $_[1], -1; # Preserve trailing fields } #line 313 sub catpath { my ($self,$volume,$directory,$file) = @_; if ( $directory ne '' && $file ne '' && substr( $directory, -1 ) ne '/' && substr( $file, 0, 1 ) ne '/' ) { $directory .= "/$file" ; } else { $directory .= $file ; } return $directory ; } #line 358 sub abs2rel { my($self,$path,$base) = @_; $base = $self->_cwd() unless defined $base and length $base; ($path, $base) = map $self->canonpath($_), $path, $base; if (grep $self->file_name_is_absolute($_), $path, $base) { ($path, $base) = map $self->rel2abs($_), $path, $base; } else { # save a couple of cwd()s if both paths are relative ($path, $base) = map $self->catdir('/', $_), $path, $base; } my ($path_volume) = $self->splitpath($path, 1); my ($base_volume) = $self->splitpath($base, 1); # Can't relativize across volumes return $path unless $path_volume eq $base_volume; my $path_directories = ($self->splitpath($path, 1))[1]; my $base_directories = ($self->splitpath($base, 1))[1]; # For UNC paths, the user might give a volume like //foo/bar that # strictly speaking has no directory portion. Treat it as if it # had the root directory for that volume. if (!length($base_directories) and $self->file_name_is_absolute($base)) { $base_directories = $self->rootdir; } # Now, remove all leading components that are the same my @pathchunks = $self->splitdir( $path_directories ); my @basechunks = $self->splitdir( $base_directories ); if ($base_directories eq $self->rootdir) { shift @pathchunks; return $self->canonpath( $self->catpath('', $self->catdir( @pathchunks ), '') ); } while (@pathchunks && @basechunks && $self->_same($pathchunks[0], $basechunks[0])) { shift @pathchunks ; shift @basechunks ; } return $self->curdir unless @pathchunks || @basechunks; # $base now contains the directories the resulting relative path # must ascend out of before it can descend to $path_directory. my $result_dirs = $self->catdir( ($self->updir) x @basechunks, @pathchunks ); return $self->canonpath( $self->catpath('', $result_dirs, '') ); } sub _same { $_[1] eq $_[2]; } #line 439 sub rel2abs { my ($self,$path,$base ) = @_; # Clean up $path if ( ! $self->file_name_is_absolute( $path ) ) { # Figure out the effective $base and clean it up. if ( !defined( $base ) || $base eq '' ) { $base = $self->_cwd(); } elsif ( ! $self->file_name_is_absolute( $base ) ) { $base = $self->rel2abs( $base ) ; } else { $base = $self->canonpath( $base ) ; } # Glom them together $path = $self->catdir( $base, $path ) ; } return $self->canonpath( $path ) ; } #line 477 # Internal routine to File::Spec, no point in making this public since # it is the standard Cwd interface. Most of the platform-specific # File::Spec subclasses use this. sub _cwd { require Cwd; Cwd::getcwd(); } # Internal method to reduce xx\..\yy -> yy sub _collapse { my($fs, $path) = @_; my $updir = $fs->updir; my $curdir = $fs->curdir; my($vol, $dirs, $file) = $fs->splitpath($path); my @dirs = $fs->splitdir($dirs); pop @dirs if @dirs && $dirs[-1] eq ''; my @collapsed; foreach my $dir (@dirs) { if( $dir eq $updir and # if we have an updir @collapsed and # and something to collapse length $collapsed[-1] and # and its not the rootdir $collapsed[-1] ne $updir and # nor another updir $collapsed[-1] ne $curdir # nor the curdir ) { # then pop @collapsed; # collapse } else { # else push @collapsed, $dir; # just hang onto it } } return $fs->catpath($vol, $fs->catdir(@collapsed), $file ); } 1; FILE24e8b8c3/List/Util.pmy#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/i686-linux/List/Util.pm" # List::Util.pm # # Copyright (c) 1997-2009 Graham Barr . All rights reserved. # This program is free software; you can redistribute it and/or # modify it under the same terms as Perl itself. # # This module is normally only loaded if the XS module is not available package List::Util; use strict; use vars qw(@ISA @EXPORT_OK $VERSION $XS_VERSION $TESTING_PERL_ONLY); require Exporter; @ISA = qw(Exporter); @EXPORT_OK = qw(first min max minstr maxstr reduce sum shuffle); $VERSION = "1.23"; $XS_VERSION = $VERSION; $VERSION = eval $VERSION; eval { # PERL_DL_NONLAZY must be false, or any errors in loading will just # cause the perl code to be tested local $ENV{PERL_DL_NONLAZY} = 0 if $ENV{PERL_DL_NONLAZY}; eval { require XSLoader; XSLoader::load('List::Util', $XS_VERSION); 1; } or do { require DynaLoader; local @ISA = qw(DynaLoader); bootstrap List::Util $XS_VERSION; }; } unless $TESTING_PERL_ONLY; if (!defined &sum) { require List::Util::PP; List::Util::PP->import; } 1; __END__ #line 234 FILE8bb6a217/Scalar/Util.pm#line 1 "/usr/lib/perl5/vendor_perl/5.12.2/i686-linux/Scalar/Util.pm" # Scalar::Util.pm # # Copyright (c) 1997-2007 Graham Barr . All rights reserved. # This program is free software; you can redistribute it and/or # modify it under the same terms as Perl itself. package Scalar::Util; use strict; use vars qw(@ISA @EXPORT_OK $VERSION @EXPORT_FAIL); require Exporter; require List::Util; # List::Util loads the XS @ISA = qw(Exporter); @EXPORT_OK = qw(blessed dualvar reftype weaken isweak tainted readonly openhandle refaddr isvstring looks_like_number set_prototype); $VERSION = "1.23"; $VERSION = eval $VERSION; unless (defined &dualvar) { # Load Pure Perl version if XS not loaded require Scalar::Util::PP; Scalar::Util::PP->import; push @EXPORT_FAIL, qw(weaken isweak dualvar isvstring set_prototype); } sub export_fail { if (grep { /dualvar/ } @EXPORT_FAIL) { # no XS loaded my $pat = join("|", @EXPORT_FAIL); if (my ($err) = grep { /^($pat)$/ } @_ ) { require Carp; Carp::croak("$err is only available with the XS version of Scalar::Util"); } } if (grep { /^(weaken|isweak)$/ } @_ ) { require Carp; Carp::croak("Weak references are not implemented in the version of perl"); } if (grep { /^(isvstring)$/ } @_ ) { require Carp; Carp::croak("Vstrings are not implemented in the version of perl"); } @_; } sub openhandle ($) { my $fh = shift; my $rt = reftype($fh) || ''; return defined(fileno($fh)) ? $fh : undef if $rt eq 'IO'; if (reftype(\$fh) eq 'GLOB') { # handle openhandle(*DATA) $fh = \(my $tmp=$fh); } elsif ($rt ne 'GLOB') { return undef; } (tied(*$fh) or defined(fileno($fh))) ? $fh : undef; } 1; __END__ #line 284 FILE10f34c52/auto/Fcntl/Fcntl.so5ELF4(14 (XX)))lt...QtdRtd)))e(?*$%"! (' &)#   # H #$%')TUqXCE.6bx|?M + mr1| K;\ b"! 8 =l06l0P   It0__gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesPerl_get_hvPerl_hv_common_key_lenPerl_newSV_typePerl_sv_upgradeboot_FcntlPL_stack_spPL_markstack_ptrPL_stack_basePerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpXS_Fcntl_constantPerl_newXSPerl_newSVivPerl_newCONSTSUBPL_sv_yesPL_sub_generationPL_unitcheckavPL_scopestack_ixPerl_call_listPerl_sv_free2Perl_sv_setpvnPerl_sv_freePerl_formPerl_get_svPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_croakPerl_croak_xs_usagelibc.so.6_edata__bss_start_endGLIBC_2.1.3,si N ),)8)D)P)\)h)t))))))))))))***(*4*@*L*X*d*p*|***********+ ++$+0+<+H+T+`+l+x++++++++++++,, ,,,8,D,P,\,h,t,,,,,,,,,,,,---(-4-@-L-X-d-p-|-------------.... .(.0.8.@.H.P.X.`.h.p.x...............h0//// / //#////!000 0000 0 0 $0(0,0004080<0@0D0H0L0P0T0X0\0`0 d0"Up  hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPUS[H tfX[ÐUVS xu]tt$T|)9s ||9rƃx[^]US.Ûtt $Ѓ[]Ë$ÐUVSZ0D$`$O\D$D$D$ 0D$T$$1t @ t @ 0[^]Ív$ $zvB J0[^]Ð$D$EEEҍUWVS,Ù\9GEЋ1MЉE̋@ X@ E)ƒMЋ|EtD$$<$ƍyD$MG4$D$<$ƉD$S1҅tFFtGjGJD$D$$D$$_E,ɉE,<} }f9z HOF$MD$D$UD$ 0NjFT$ $D$XJMԁMfE\U E|$$D$+oU܉MMD$MD$D$ 0VD$ $T$BȃQfu Qt }@tWU|$$D$vJ tQ2҉Qfb<B$@ D$M؉|$D$ $FD$ $D$.tD$$PMЋL[^_]ÍvU뛐ED$D$4$EmN^n~.>N^n~h0.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.data.rel.ro.dynamic.got.got.plt.data.bss oP Z%oT2o@@ A ``J   S N Y _88e2TTmTTw))~)))) ) ) ..//,//th0h0l0l0l0FILE228c0fb7/auto/IO/IO.soE4ELF4tA4 (8383>NN >NNQtdRtd>NNPPe(PI "07$ +8 (N<%/DE1;.2#HG:4K>=93*OC@,?- M'!AL B)FJ 65&<@ )$ $Dz<>?ABCDEFGHIKLNO}ScYVqX6˞|ۯa?*󶚿y }ͻ0w>qU2?wCE칍QY6Yy06 + Vojf|USKeDg$%/ EIu"r> \0&S 0 "P)m  P  P- ?p $ .   " q %  4' ! Pp +  __gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesXS_IO__Handle_setvbufPL_markstack_ptrPL_stack_spPL_stack_basePerl_croakboot_IOPerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpXS_IO__Seekable_getposPerl_newXSXS_IO__Seekable_setposXS_IO__File_new_tmpfileXS_IO__Poll__pollXS_IO__Handle_blockingPerl_newXS_flagsXS_IO__Handle_ungetcXS_IO__Handle_errorXS_IO__Handle_clearerrXS_IO__Handle_untaintXS_IO__Handle_flushXS_IO__Handle_setbufXS_IO__Handle_syncXS_IO__Socket_sockatmarkPerl_gv_stashpvnPerl_newSVivPerl_newCONSTSUBPL_unitcheckavPL_scopestack_ixPerl_call_listPL_sv_yesPerl_formPerl_get_svPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_sv_freePerl_sv_free2Perl_sv_2ioPerl_croak_xs_usagePerl_PerlIO_filenoPerl_sv_newmortalPerl_sv_setivPerl_sv_setpvnfsync__errno_locationPerl_PerlIO_flushPL_opPL_curpadPerl_mg_setPerl_PerlIO_clearerrPerl_PerlIO_errorPerlIO_ungetcPerl_sv_2iv_flagsfcntlPL_sv_undefPerl_newSVPerlIO_tmpfilePerl_newGVgenPerl_hv_common_key_lenPerl_do_opennPerl_newRVPerl_gv_stashpvPerl_sv_blessPerlIO_setposPerlIO_getposlibc.so.6_edata__bss_start_endGLIBC_2.1.3GLIBC_2.2.4GLIBC_2.0si ti ii POFOGO?OOO O OIOEOOLOOOJOOOOOBODOKO)O<O6O=OHO9PPP PPPPP P $P (P,P0P4P8PD$3$@wD$FD$E$$RU$D$QD$$-M $D$\D$$D$gD$E$$U$D$rD$z$M $D$zD$U$ D$D$E$0D$D$ $$ESU$D$D$$.M $D$D$$ D$D$E$$U$D$D${$M $D$D$V$D$D$E$1tD$$1El[^_]ÐEԍML$ $MĉD$D$$Mąt@<fAEԍUT$ $D$D$$afUȉMD$"D$$MċUȉEt&E$m$UUҋUȉE MԍEЉMtM܉$U1$M̉L$MD$EԉL$MЉD$$L$ML$M܉L$ -$EMċU&$EgEMĉ$RMfMĉ$=Mt&Mĉ$Mst&Mĉ$M~t&B f@tt&$ EEЉMEA D$$&'U(]i0}u224<2)~2D$H u202]u}]ÍD$E$7D$t$?&UWVS0, 9  )E$@$$'MMEwMU܃tt&T$$5E䋓,[^_]ÍD$D$ $ʍD$E$*fUWVS)/, 9  )E$ @ $$?MMEMU܃tt&T$$=E䋓,[^_]ÍD$D$ $ʍ&}> 몍D$E$v'UWVS ., 9  )E$@ t{$MMEkMU܃tt*T$$)E䋓,[^_]Ít&D$D$ $ƍ&}>릍D$E$fUWVS,, 9  )E@ tnH 4$tmHM1D$4$UF @t4$M䋓4E,[^_]ÍUU܉$Su뉍D$E$UWVS+, 9  )E$P@ }H 4tS$K1D$4$UF @t4$dM䋓4E,[^_]Ív륍UU܉D$E$'UWVSl*, 9  )E$P@ tyH 4tO$OD$4$UF @t4$JM䋓4E,[^_]Ð맍UU܉농D$E$t&UWVS\ù),00<)z M܋U؉$U؋HD@ @E@ P EtRE $D$CMD$U $E@ @t$UM E,[^_]k뫍MM؉E낉MD$$EM؉EAD$E$e'UWVSY(,0 )N\JMM܋M$U4U؋HEt D@ @E $MD$D$$EM؅Euq9t& $U]UD$T$$x]U1$U$_U؋E,[^_]Ðt&}u뇍v ME,[^_]fD$$M}MD$E$&UWVS<Ù&\0 M܋ )M܃<}Ћ@ @E؃Ủu$5ỦEԋx E܍4 u1M<@ EE@ tO@fDfDEE9u~MM@ uUD$$LU뤍&EĉUD$$*U뜐t&M؋uỦ<$L$t$U̅ExjtfM1} ϐM L$ EȉỦ $MULL$ 9 $EȋŨ9uuԋFtaFtoE؋u2Ủ$$ŰE\[^_]fUD$$5ỦE=f}ԉỦ<$:U떐t&Ủ4$U끍D$E$+vUWVS)$L114)E@ b@ EGU$E)@PD$D$D$ DJT$L$$M܍.D$ D$D$L$D$D$ D$D$4$uYMtFFE䋓L[^_]Ð%UMt&U4$UP$U؉ED$$pUD$$LFu4$HuvD$D$$E4$ED$E$UWVS",9 )W MU$L@tzL$$nMM܉oM܃Utt&|$$-E䋓,[^_]ÍD$D$ $ʍ&}>몍2D$E$v'U8] u} 9  )E$PtUMU܉M]MU܋$D$t E䋓]u}]ÍvˍD$E$ UVS t&Ћu[^]US[Y[Usage: IO::Handle::setvbuf(handle, buf, type, size)%s not implemented on this architecture%s object version %-p does not match %s%s%s%s %-pIO::Handle::setvbufXS_VERSION%s::%s1.25_02version::bootstrap parameterIO.cIO::Seekable::getposIO::Seekable::setposIO::File::new_tmpfileIO::Poll::_poll$;$IO::Handle::blockingIO::Handle::ungetcIO::Handle::errorIO::Handle::clearerrIO::Handle::untaintIO::Handle::flushIO::Handle::setbufIO::Handle::syncIO::Socket::sockatmarkIO::PollPOLLINPOLLPRIPOLLOUTPOLLRDNORMPOLLWRNORMPOLLRDBANDPOLLWRBANDPOLLERRPOLLHUPPOLLNVALIO::Handle_IOFBF_IOLBF_IONBFSEEK_SETSEEK_CURSEEK_ENDhandle, ...sock0 but truehandlehandle, chandle, blk=-1timeout, ...packname = "IO::File"IO::File+>&handle, pos p 0oh h  Oooo0oN.>N^n~.>N^n~.>N^n~P.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss o hhh h %o002o@A J  SppN Yh_00e24040m4343wN>~N>N>N>O?hO?P@P@@FILE%3fe85bb5/auto/PerlIO/scalar/scalar.so5ELF414 (4%4%.>>DL/??QtdRtd.>>e(L 1 AI/E+D-@.3>0)<?&874*6!"$C,=B KG#H(2';9J :5%F .3"т(F  8 3456789;=>?@BCDEFGHIJK/ϧs:ij{CEpqX+v=?9 `))v$vo 9*v|:EOf++v:; d@4X + x~S r,D] /2*>gTE"!c !5  q  9 t0A?  {0AS P #`v b ` } e  ( [ K0 8Aw $ M 6@pu ` L __gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesPerlIOScalar_filenoPerlIOScalar_tellPerlIOScalar_fillPerlIOScalar_flushPerlIOScalar_poppedPerl_sv_freePerl_sv_free2boot_PerlIO__scalarPL_stack_spPL_stack_basePL_markstack_ptrPerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpPerlIO_scalarPerlIO_define_layerPL_unitcheckavPL_scopestack_ixPerl_call_listPL_sv_yesPerl_formPerl_get_svPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_croakPerlIOScalar_dupPerlIOBase_dupPerlIOScalar_argPerl_newRV_noincPerlIO_sv_dupPerl_newSVsvPerlIOScalar_openPerlIO_pushPerlIO_arg_fetchPerlIO_allocatePerlIOScalar_set_ptrcntPerl_mg_getPerlIOScalar_bufsizPerlIOScalar_get_cntPerlIOScalar_get_basePerlIOScalar_get_ptrPerlIOScalar_writememmovePerl_mg_setPerl_sv_growPerlIOScalar_readmemcpy__errno_locationPerlIOScalar_seekmemsetPerl_ckwarnPerl_warnerPerlIOScalar_closePerlIOBase_closePerlIOScalar_pushedPerlIOBase_pushedPerl_sv_upgradePL_no_modifyPerlIOBase_binmodePerlIOBase_eofPerlIOBase_errorPerlIOBase_clearerrPerlIOBase_setlinebuflibc.so.6_edata__bss_start_endGLIBC_2.1.3GLIBC_2.0jsi ii @@??? ????!?H?%?-?1@3@=@>@@<@8@B@C@J@I@:A4AEA@ AAAA)A? AG$A6(A5,AK@@@ @@?@@@ @ $@ (@ ,@0@4@8@<@@@D@H@L@P@T@X@\@ `@"d@#h@$l@&p@'t@(x@*|@+@,@-@.@/@0@2U}( hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(US[8+tX[ÐUVS +<u]t$L@)9s @@9rƃ<[^]US.Ë*tt $Ѓ[]Ë$ÐU]ÍUE]P@U]ÍU1]É'UE]u*0F tPt҉Pt$F ]1u]Ð$@⍶$`ҍ&'UWVS<Ù)lE䋃rE؋@ @ EԍU)ƒ!TEUD$$Uȉ$E܍D$SUȄ0BUUD$$M $D$E 1ɋUȅOtBBEtUBBT$tD$$ El[^_]ÐEԍML$ $MĉD$D$$sMąt@<fEԍUT$ $D$D$$)ffUȉMD$"D$$"MċUȉEt&E$e$MUҋUȉE MԍEM܍MЉ$U)$M̉L$MD$EԉL$MD$$L$M܉L$MЉL$ U$EMċU&$EEMĉ$M#fMĉ$Mt&Mĉ$Mt&Mĉ$Mt&B f@tt&EME܉EA D$$.&'U(E]%uu D$ E}t$D$E$tqyrz]u}]Ðt&USEU%Â%@ uu9t@$ []ÍvU $T$$[]Ív$X$[]Ív'U(M(]%}}$ɉu~LE,01F t+tPEt$ <$D$ED$t J ]u}]Ít&ED$E $nfǐ릍&'UE]u`$0F @ t $F @+EFF]u]Ít&UE]u$01F tF @ u@]u]Ít&$HF vUE]uc#0F t&F @ u-V@9v])Ћu]Ðt&]1u]Ít&$F V@9w UE]u@#01F tF P ut$@ ]u]Ít&$pF PuD$D$$]u]ÍvU1U]uaþ"2F t $DF]u]Í&U1XU]u}:y"Ow F  UA9Q 2V U؋MEEEUEMEUMUOWMEE؉L$M $L$W;PvPFD@FE]u}]ËWGEUċUEUUEEUĉE؉U܋A1҃}UԉE}BF E؋UMUMĉWOXt&Ủ4$ŰH tv9E؍vvUU9Q r;N M맍v4$CvT$4$E؋@&T$4$E؋WOUMT&U8E]Vó }}utt0FtRF @ tiJM@ V)tOE 9FT$|$$1҉~V]u}]Ðt&F 1ٍv1ҍt&UD$T$$M농t&UhE]uu }}B @ }IM}Mu{rz9uur%x HD1]u}]Ít&E܋;p u܋EM+EN U؉D$D$ $,U؋B 몍t&rz냉U؉$U؃}B IMIrzrzOt&MEMu}-M܉t$U؉ $U؋r uVq !UD$$xU؋B $tD$$fU]Fuu4$.b]u]Ít&'UWVS,E}7$P@ D$$Tt@F PED$<$D$ E D$‹F Hft It@HF yF~@ @tU$U,[^_]Ðt&U @ t@ u@@F H у9D$$U$U :rt$Kt $D$D$7SfFF*t&H fAt&уt8D$ D$$F PaH A뿐D$D$$v$HF HfvD$$RUVS=Út&Ћu[^]US[`@Y[XS_VERSION%s::%s0.08version::$bootstrap parameterOffset outside stringscalar%s object version %-p does not match %s%s%s%s %-pj ( $o`l   ?0 oooo?Vfv&6FVfv&6FVfv@p$.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bssl o``L l l %o2o0A  J 0 S((N@@pY_$$e2$$m0%0%w>.~>.>.?/?/,?/@0 0A0101FILE5b8bc3be/auto/Cwd/Cwd.so5ELFP4@14 (TT......QtdRtd...((e([94/ ' )03 61!#".* 5+8,%($- &72 0h@ 0124578XCEqX{+o|+=, +  ZJ&"Hbo.cWx"jsT8I?@ 0 0    @ 0@ __gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesboot_CwdPL_stack_spPL_stack_basePL_markstack_ptrPerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpXS_Cwd_fastcwdPerl_newXSXS_Cwd_getcwdXS_Cwd_abs_pathPL_unitcheckavPL_scopestack_ixPerl_call_listPL_sv_yesPerl_formPerl_get_svPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_sv_freePerl_sv_free2Perl_croakPL_opPL_curpad__errno_locationPerl_my_strlcpystrchr__memcpy_chk__memmove_chkPerl_my_strlcat__lxstat64readlinkstrrchrPerl_sv_setpvnPL_taintingPerl_sv_magicPerl_mg_setPL_sv_undefPerl_sv_setsv_flagsPerl_sv_newmortalPerl_croak_xs_usagePerl_getcwd_svlibc.so.6__stack_chk_fail_edata__bss_start_endGLIBC_2.1.3GLIBC_2.4GLIBC_2.2GLIBC_2.3.4GLIBC_2.0si ii ii ti  ii 0////////5////6/8/"/)/,000 00 0 0 0 0 $0(0,0004080<0@0D0H0L0P0T0X0 \0!`0#d0$h0%l0&p0't0(x0)|0*0+0-0.0/U]S hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhUS[Ø tX[ÐUVSj u]t$<)9s 9rƃ[^]US.tt $Ѓ[]Ë$ÐUWVSélE䋃rE؋@ @ EԍU)ƒyTEUD$$;Uȉ$E܍D$UȄBUUD$$nM $D$E1ɋUȅtBhBrEtUB-BgT$UȉD$$"UȉD$T$$UȉD$T$$tD$$dEl[^_]Ít&EԍML$ $MĉD$kD$$Mąt@<fIEԍUT$ $D$!D$$fUȉMD$"D$$jMċUȉEt&E$$UҋUȉE MԍEЉMM܉$Uq$IM̉L$MD$EԉL$MЉD$($L$ML$M܉L$ $EMċU&$EoEMĉ$MfMĉ$mMt&Mĉ$5M{t&Mĉ$Mt&B f@tvEEЉMEA D$$vUWVSé@}eE1114)1Xt<@ OP \$t G w 'TL>/D$t$Tt!%tDWDt$D$+t4$pp p0h$#DžPld`(&hR:P'pD$/4$/pɍE)thT$DHD$ t$$D+tpƄHt0pD$ 4$D$tD$Hlt|:/tG=l:/D:ǀh$d9$`9$hlHD$D$$H=xD$lH$D$"H %=APDlHD$p$D$eH=Ƅ/wv@lD8D$/$DHT@HxD+ltM/tB=Ƅ/ƄpD$t$ $=pPD$D$4$Ipp&t&vtD:8/t !%t\DJDt+t4$L$T$F%_DF?4$D$D$ D$tD$F@2\ $Yt&hB`:BVhB`:B=lD9D$/ $zx@+lT$t&\D$D$ $x\F@2/X\DHp?t(D$D$ D$tD$ $sUe30?@[^_]ËT$G&\ƅ/Fƅt~D$D$4$p1t&D$D$<$UqƅT$T:xL +tt$D$D$$5T($D$<$Ut&UH]æu} M@ P 44$F @8uVUxp8t(D$D$ D$tD$4$_8]u}]f4$ 렍Ɛwt&'UH] u} 9 )@ P 44$F @uUxp8t(D$D$ D$tD$4$a:]u}]Ít&U4$UƐxD$E$fUSûUVSÚt&Ћu[^]US[`Y[XS_VERSION%s::%s3.31version::$bootstrap parameterCwd.cCwd::fastcwdCwd::getcwdCwd::abs_pathpathsv=Nullsv..%s object version %-p does not match %s%s%s%s %-p oLL ! /  @ o oon o. & 6 F V f v &6FVfv&6F0.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bssX oLLp LL!%on n r2o `A @ @ J   S N PYPP8_e2mPPw..~......//@//00000FILE'8742279b/auto/Compress/Raw/Zlib/Zlib.soELF.44 ($$HPQtdRtd00e($+kc~$4CJ%]wxK&t^MhnG<l-0rjVT|5D;d8{(UH`#mpvI2 so_g F19S>bPQO,fA \R=eEZz!) Xu6BL3iW[":?@.y *Yq}/N' 7auT H "BJ DB ( (6Z@L@+' 6 TUVWXYZ[]^_`adefghijkmnoqstuvwxy{|}~-=q2e -qo;s#k(&8iF;[X_A=şv8!iCȇ+| 0$eqX J)X1{o-t{(7+8eUL1;epؿ+CE+LA) OEƥ _ï1z" azlnKRWaLnBuBkJ[)K =Ɵ9\ $  m  2  + R  N  k XHV $ i= Z r~7a o c' Gv ^   h  A  (  J:    P" du qZs _s `t Bs Hs Dgc Tcs $es _Ss H* 4 <s f ? r `) nGs Ds ,Ts  P  `j  o " Ms h@^   0s 0) >hc H >~ p 3@~@ `v `s ?/P  ZNs  s Js 8  Ys @  F As g -Ps 0 Ks Ws bs E~ R|@ y kc ;s Qs ]s Vs : m s o C\s __gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesboot_Compress__Raw__ZlibPL_stack_spPL_stack_basePL_markstack_ptrPerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpXS_Compress__Raw__Zlib_constantPerl_newXSXS_Compress__Raw__Zlib_zlib_versionXS_Compress__Raw__Zlib_ZLIB_VERNUMXS_Compress__Raw__Zlib_adler32XS_Compress__Raw__Zlib_crc32XS_Compress__Raw__Zlib_crc32_combineXS_Compress__Raw__Zlib_adler32_combineXS_Compress__Raw__Zlib__deflateInitXS_Compress__Raw__Zlib__inflateInitXS_Compress__Raw__Zlib__deflateStream_DispStreamXS_Compress__Raw__Zlib__deflateStream_deflateResetXS_Compress__Raw__Zlib__deflateStream_deflateXS_Compress__Raw__Zlib__deflateStream_DESTROYXS_Compress__Raw__Zlib__deflateStream_flushXS_Compress__Raw__Zlib__deflateStream__deflateParamsXS_Compress__Raw__Zlib__deflateStream_get_LevelXS_Compress__Raw__Zlib__deflateStream_get_StrategyXS_Compress__Raw__Zlib__deflateStream_get_BufsizeXS_Compress__Raw__Zlib__deflateStream_statusXS_Compress__Raw__Zlib__deflateStream_crc32XS_Compress__Raw__Zlib__deflateStream_dict_adlerXS_Compress__Raw__Zlib__deflateStream_adler32XS_Compress__Raw__Zlib__deflateStream_compressedBytesXS_Compress__Raw__Zlib__deflateStream_uncompressedBytesXS_Compress__Raw__Zlib__deflateStream_total_inXS_Compress__Raw__Zlib__deflateStream_total_outXS_Compress__Raw__Zlib__deflateStream_msgXS_Compress__Raw__Zlib__deflateStream_deflateTuneXS_Compress__Raw__Zlib__inflateStream_DispStreamXS_Compress__Raw__Zlib__inflateStream_inflateResetXS_Compress__Raw__Zlib__inflateStream_inflateXS_Compress__Raw__Zlib__inflateStream_inflateCountXS_Compress__Raw__Zlib__inflateStream_compressedBytesXS_Compress__Raw__Zlib__inflateStream_uncompressedBytesXS_Compress__Raw__Zlib__inflateStream_inflateSyncXS_Compress__Raw__Zlib__inflateStream_DESTROYXS_Compress__Raw__Zlib__inflateStream_statusXS_Compress__Raw__Zlib__inflateStream_crc32XS_Compress__Raw__Zlib__inflateStream_dict_adlerXS_Compress__Raw__Zlib__inflateStream_total_inXS_Compress__Raw__Zlib__inflateStream_adler32XS_Compress__Raw__Zlib__inflateStream_total_outXS_Compress__Raw__Zlib__inflateStream_msgXS_Compress__Raw__Zlib__inflateStream_get_BufsizeXS_Compress__Raw__Zlib__inflateStream_set_AppendXS_Compress__Raw__Zlib__inflateScanStream_DESTROYXS_Compress__Raw__Zlib__inflateScanStream_DispStreamXS_Compress__Raw__Zlib__inflateScanStream_inflateResetXS_Compress__Raw__Zlib__inflateScanStream_scanXS_Compress__Raw__Zlib__inflateScanStream_getEndOffsetXS_Compress__Raw__Zlib__inflateScanStream_inflateCountXS_Compress__Raw__Zlib__inflateScanStream_compressedBytesXS_Compress__Raw__Zlib__inflateScanStream_uncompressedBytesXS_Compress__Raw__Zlib__inflateScanStream_getLastBlockOffsetXS_Compress__Raw__Zlib__inflateScanStream_getLastBufferOffsetXS_Compress__Raw__Zlib__inflateScanStream_resetLastBlockByteXS_Compress__Raw__Zlib__inflateScanStream__createDeflateStreamXS_Compress__Raw__Zlib__inflateScanStream_statusXS_Compress__Raw__Zlib__inflateScanStream_crc32XS_Compress__Raw__Zlib__inflateScanStream_adler32zlibVersionPerl_get_svPerl_sv_setivPL_unitcheckavPL_scopestack_ixPerl_call_listPL_sv_yesPerl_formPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_sv_freePerl_sv_free2Perl_croakPL_opPL_curpadPerl_sv_setuvPerl_mg_setPerl_sv_newmortalPerl_sv_2iv_flagsPerl_croak_xs_usagePerl_sv_setpv__errno_locationstrerrorPerl_sv_setnvPerl_safesysmallocdeflateInit2_Perl_safesysfreePL_stack_maxPerl_sv_setref_pvdeflateSetDictionarydeflatePrimePerl_newSVivPerl_sv_2uv_flagsPerl_dowantarrayPerl_stack_growPerl_sv_2pvbytePL_sv_noPerl_sv_2boolPL_curcopPerl_sv_utf8_downgradePerl_newSVpvPerl_mg_get__printf_chkinflateEndmemmovePerl_sv_backoffPL_compilingPerl_sv_upgradePerl_sv_pvbyten_forcePerl_sv_growinflateSetDictionaryPerl_sv_utf8_upgrade_flags_growdeflateEndinflateInit2_Perl_newSVsvPL_sv_undefPerl_sv_setpvnmemcpylibz.so.1libc.so.6_edata__bss_start_end/usr/libGLIBC_2.1.3GLIBC_2.3.4GLIBC_2.0si ti ii Ya T   [bh}ys ztj $q(,0e48n<m@ZDUH$L`PTwX\`(d_h^l+pt0xf|2xoi\Vv|rWc?CXpdlMP   $ (,048<@DHLPTX\`d h!l"p#t%x&|')*,-./13456789:;<=>@ABDEFGHIJKLMNOQ RSUm賘 hhhhh h($h0(h8p,h@`0hHP4hP@8hX0<h` @hhDhpHhxLhPhThXh\h`hdhhhplh`phPth@xh0|h hhhhhhhh h(h0h8ph@`hHPhP@hX0h` hhhphxhhhhhhhhph`hPh@h0h hhh hhhhh US[(tX[ÐUVS$u]t $<()9s ((9rƃ$[^]US.{tt $Ѓ[]Ë$ÐUWVS9l E䋃TrE؋@ ` @ EԍU)ƒTEUD$$;Uȉ$E܍D$UȄ BUUD$$M $D$E<1ɋUȅtB B EtUBu B  UT$D$$(MD$4L$$ED$XD$X$UD$T$$MD$L$$ED$$D$|$w0UD$T$$XMD$L$$9E䋓D$T$Uȉ$@ M䍃Uȉ$L$T$@ ED$D$8$tUD$hT$$MD$L$$ED$`D$$mUD$T$$N8MD$ L$$/ED$D$T$LUD$T$$MD$L$$ED$D$$PUD$T$$|MD$@L$$uED$ D$p$VUD$T$$7MD$L$$ED$@D$$\UD$8T$$MD$hL$$ED$D$$UD$T$$}MD$L$$^ED$,D$$$?UD$PT$$ MD$L$$ED$D$$UD$T$$MD$ L$$ED$D$L$UD$xT$$fDMD$L$$GED$D$$(UD$T$$ MD$0L$$ED$D$`$UD$T$$MD$L$$ED$D$$nUD$T$$OMD$LL$$0ED$HD$$UD$T$$t&B f@tpt&QEEЉME$A D$8$UWVS, T1 )4B J < M@ lT$U$U@ @ tf@@U<$D$UG @tU<$#UUԁ A tU+0 D<[^_]Ív$D$ELQUky G‰cD$ $@fl9D$D$"|$ $迹GD$E$芹v'UWVS<É{, T00<)yL1҅t+QIRU} M@ $L$UM܉$EUM܄@ @ tx@ҋu=ʃu=$E䋓 ,[^_]Ít&ʃtËlft3R@t&UD$$ Uqt&t3 t&Ut)Q :0v $0‹&19D$D$"L$ $轷OD$E$舷&UWVS<Éy\ E܋TM܋2)щ0B RUTB ^RUЋTB (RUԋT B RUTB RU؋TB &JTB 5RUċDMEMEЉFXUԉV\EF`U؍F NhVdEȍAD$8D$L$T$UT$ MԉL$EЉD$Uȉ$菵M̋xteQ t@  jD$M̉ $7|$D$Eȉ$tNjF끍t&<$0$X}E\$$EӳUQD$$U3UJ")F 0\[^_]Ð$D$`TB D$$M+MEċD$$E؋jvvT$$D$M豲M&D$$ED$$蠳EԋD$$耳EЋD$$`EZŰB t&t$4$D$UU&UWD$ $Xt%ŰRx$D$E$p$U(]uƉ}@茴t |t7v F ЍJt|$$蘲ЃtHtQD$$Ɖ]u}]Í&4$ЮFtF @믐4$谮FЍJo|$$ UWVS蜳sL 0T )NUŰUԋ 4@ mP EЍwH  ED$$蕯EMԋTB<@U$T$UȉT$ӮMЋ7 $D$肮E@ @t$ѯUԋMЉ EL[^_]Ív@ 8$UD$諯UĄJ v@ER UD$D$$&&MMĉEt&J AD$$蘮WD$E$讯 $UWVS\éqL 0T )NUŰUԋ 4@ mP EЍ7H  ED$$UEMԋTB<@U$T$UȉT$胮MЋ7 $D$BE@ @t$葭UԋMЉ EL[^_]Ív@ 8$UD$kUĄJ v@ER UD$D$$ĭ&&M蠬MĉEt&J AD$$XkD$E$nP$耭UWVSio, T 9  )fE@  lT$U܉$]U܄@ @ HA M؉$荩M؅ME܉M肫M؉U܋UE\$$sU܉D$$ة H"E,[^_]Í&D$$^A`D$AD$rUUU܉\$$ݪQil9D$LD$"T$ $֫9D$E$衫UWVS\ém, T 9  )fE@  T$U܉$蝫U܄@ @ HA M؉$ͧM؅ME܉M©M؉U܋UE\$$賩U܉D$$ H"E,[^_]Í&D$$P^A`D$AD$UU%U܉\$$Qi9D$D$"T$ $9D$E$UWVS蘫k,D$$D$Φt|$D$$谦PED$$藦F D$D$$rF,$D$D$UF0$D$D$8F4$D$D$F$xD$"D$$F $D$RD$٥~ tOl1D$$躥V pu܉ƉUU:t$$D$若u݋u܋E$D$pF$D$vD$SNtOl1D$$4Vpu܉ƉUU:t$$D$u݋u܋E$D$F$D$D$ǤF$D$D$誤F$D$D$荤F $D$D$pF<$D$D$SFD$D$D$6FH$D$,D$FL$D$GD$FT$D$cD$ޣF$D$|D$F$D$D$褣$D$D$舣U$DljD$D$]E$DljD$D$:E$DljD$D$E$DljD$)D$BE}D$$|$ӢF|$D$[D$趢E$D$裢,[^_]Ív;D$$肢t&D$$b,[^_]Ív'UWVS9g, T9 )J@ lL$UM܉$1UM܄@ @ t]@Et(TB<t{t% =uMR 1ҋE ,[^_]Ðt&UD$$UE됐t&$D$舢릍t&J Ayl9D$D$"L$ $vD$E$轣'UWVSlùe, T9 )J@ L$UM܉$豣UM܄@ @ t]@Et(TB<t{t% =uMR 1ҋE ,[^_]Ðt&UD$$蕢UE됐t&$D$릍t&J Ay9D$D$"L$ $rvD$E$='UWVS9d, T9 )J@ L$UM܉$1UM܄@ @ t]@Et(TB<t{t% =uMR 1ҋE ,[^_]Ðt&UD$$UE됐t&$D$舟릍t&J Ay9D$8D$"L$ $vD$E$轠'UWVSlùb, T224)M@ @ @ t`pF $@FHtPtZ҉Pt`F|t$I4$AM䋓 ,[^_]Ðt&D$$둍t&$萜릍$`떍9D$E$詟9D$D$$觟&UWVS<Éa, T224)M@ @ @ t`pF $FHtPtZ҉Pt`F|t$4$M䋓 ,[^_]Ðt&D$$萞둍t&$`릍$0떍9D$E$y9D$ D$$w&UWVS Y`L T00<)syLU؉M@ &T$Uԉ$FUԄ @ @ @EċEH :% =p$UD$ݛUԋMĉA @AAAȃ Uԉ$MĉEAPAUԉE܅ AJ @B @UUܛUԉE\$$ӛUQtE.D$$- H"EL[^_]Ít&Eċ@ EċB% =B M܉Uԉ$L$MĉL$U9@ $UD$sUԄJ% =vB D$$؛E?$v$UD$=UL9D$D$"T$ $蹛D$E$脛$薛UH]uƉ}Uԋ@h] <t8v F Ѓ uA<u]Ft 4$胛F%_DF]u}]Í9t}ԍ$|$諚v@또t&4$F<*V BvUD$4$轘UKt&4$ȖFЃV BEԉD$$Mԍ$L$'UWVS茛[\ 8T )OruLMȋT uuUЋ@ [t$$轙GM@ @ pt(UD tPu t&NDEȉME@ tB % )=9MED$ $ϕF }@FEEE@ t@ Eu UЋ@FMЋP EEEFl~ NtyD$<$蹕twftt&UЋM̋@ $DD$UЋEEȋB% =9B EȉFẺEĉFE4t&VH=F@EȋB% =2$UMD$lMU}ȉ~@ EE)EE~UFEM~ }Ћ}ȉM܉}t(E؋MЉUD$ $ՇUNjFuyMu{x $UM9D$UEEԋMB% =uB Eԍ< NF}܉M댍$UMD$蚈MUf~PMMM+M)Npu0ˈM̉}E\$$蹈"D$Ű$M̋H"E L[^_]Ít&FVFFFUFt&@%fFPMMM+M)NpB%_DBM+NHB @u7U\$$݇Q fz D$$計%$UD$UMh8$豈$訇nvD$$PED$E$S9D$D$"t$ $G&UWVS܉)J\ T004)z}ԋ|T MԉUUU@ t$$Uԋ@ @ %pNDMEȋ@ tB &% =~}D$<$蓅F MȋJNaE@ t@ u @@EċB% =$UD$ U}č 8N@ )E܀~UFEtFVFFFUF}čN M̉U؉}Ћ}UD$$muyF}V}uыU؋H $D$芅U؋EEЋB% =uB EЉ~F?E}닍vMD$ $5ԍvNjU؋FMMЉMNp+M)MNpMȋ@Ft+F~PFtuYB%_DBM+NHB @6u16M\$$(Q9u0Mԉ}E\$$W}ԉD$$M H"E\[^_]Ít&MȋA t&B FD$F D$F$wF~&L$D$F$eFQvD$$(U1~$HvED$$Mt~UȋB$UD$%U$D$E$跃9D$D$"t$ $諃$蝃'UWVS,yE, T224)M@ @ @ tPpF $FHtPtJ҉PtP4$M䋓 ,[^_]Ít&D$$萂롍t&$`붍$0릍9D$E$y9D$D$$w&UWVS YD, T 9  )fE@  T$U܉$MU܄@ @ HA M؉$M؅ME܉MrM؉U܋UE\$$cU܉ɾD$$~ H"E,[^_]Í&D$$^A`D$AD$bUUU܉\$$Qi9D$hD$"T$ $ƀ9D$E$葀UWVSLÙBLM 8T2R U؍U+UB XRUȋTB "RU܋TB RŰD EE܍V F`AUD$ 8D$M܉$L$Q}EuZUԋPtF`Mԉ $8}FHE܉D$Ủ$Uξ}u4$~lF|#4$xEE1}ltU~t$UĉT$$S}‹)4wW@u 1L[^_]ÐE$}$|Elj$\$}MQKD$<${O") >1L[^_]E t&vXv|$<$D$U|Uĉ&D$$|E̋$D$}E܋D$$}EȋMԋA% =ufA T$D$UЉ$H|4$E}E(t&t$4$D$|t&E蠺vD$Eԉ$U{U낍D$ $ }t&'UWVS~ ?, T1 )DUB  RUTB JD@ P4@ tvx D$}ԉ|$<$9qEu E8E' cu E8M.D$E$rUWVSs 4| T004)rquLuMċM@ ilUt$$qUOu@ @ puUD tPu EčJEĉ@ % )='ED$Eĉ$5nF UčN @FEFlM6t&)F8y@4=F+FF|FED$$:n}~ F @uDfuuFl++FFlFtF<dždž0v+FD$N|L$FU$mFUt+FD$N|L$FU$~oFUUvFUNFPdžUċ@Fp+FFpFxM1ҋ@dž+FFỦEȋt<UċNɉHt)Bv % =B L$t$$mUċJ @B @u7YmME\$$PmE踫uD$$k H"E|[^_]ÍvB D$ $>m UċB% )=Mċ@EA t&UD$$mUOv$lvN|%B…MEMMȸUuΉU9w6f)9r)9vЅΉ9v̉)9rfɉ)9vfEMFdžNPUċ@Fp+FFpu7kME\$$kUQ+UFVPdžUċ@Fp+FFp}u vUWuEMuuUȉuƉUfM  ‹Mȍ 9EB9uEmuċUuUdžt&EĉMD$$jMf$k[EUD$D$$MiME뎋UЃD$T$M$jMEZl9D$D$"t$ $!kD$E$j$jUVSl,t&Ћu[^]US[à,kY[XS_VERSION%s::%s2.024version::$bootstrap parameterZlib.cCompress::Raw::Zlib::constantCompress::Raw::Zlib::adler32Compress::Raw::Zlib::crc32%s: %s is not of type %sinf_s1.2.3s, bytes, modebuf, crc=crcInitialbuf, adler=adlerInitialDispStream 0x%p- %s stream pointer is NULL stream 0x%p zalloc 0x%p zfree 0x%p opaque 0x%p msg %s msg next_in 0x%p => %02x next_out 0x%p avail_in %lu avail_out %lu total_in %ld total_out %ld adler %ld bufsize %ld dictionary 0x%p dict_adler 0x%ld zip_mode %d crc32 0x%x adler32 0x%x flags 0x%x DisabledEnabled APPEND %s CRC32 %s ADLER32 %s CONSUME %s LIMIT %s window 0x%p s, message=NULL%s: %s is not a references, bufinflateSyncs, buf, output, eof=FALSEinflates, output, f=Z_FINISHflushs, buf, outputdeflateadler1, adler2, len2crc1, crc2, len2svZ_OKZ_RLEZ_NULLZ_FIXEOS_CODZ_ASCIZ_BLOCZ_ERRNZ_BINARYDEF_WBITSZ_UNKNOWNMAX_WBITSZ_FILTEREDZ_DEFLATEDZ_NO_FLUSHZ_NEED_DICTZ_BUF_ERRORZ_MEM_ERRORZ_FULL_FLUSHZ_SYNC_FLUSHZ_STREAM_ENDZ_BEST_SPEEDZ_DATA_ERRORZLIB_VERSIONMAX_MEM_LEVELZ_STREAM_ERRORZ_HUFFMAN_ONLYZ_VERSION_ERRORZ_PARTIAL_FLUSHZ_NO_COMPRESSIONZ_BEST_COMPRESSIONZ_DEFAULT_STRATEGYZ_DEFAULT_COMPRESSION%s is not a valid Zlib macros, buf, out=NULL, eof=FALSEinflateScan%s object version %-p does not match %s%s%s%s %-pCompress::Raw::Zlib::zlib_versionCompress::Raw::Zlib::ZLIB_VERNUMCompress::Raw::Zlib::crc32_combineCompress::Raw::Zlib::adler32_combineCompress::Raw::Zlib::_deflateInitCompress::Raw::Zlib::_inflateScanInitCompress::Raw::Zlib::_inflateInitCompress::Raw::Zlib::deflateStream::DispStreamCompress::Raw::Zlib::deflateStream::deflateResetCompress::Raw::Zlib::deflateStream::deflateCompress::Raw::Zlib::deflateStream::DESTROYCompress::Raw::Zlib::deflateStream::flushCompress::Raw::Zlib::deflateStream::_deflateParamsCompress::Raw::Zlib::deflateStream::get_LevelCompress::Raw::Zlib::deflateStream::get_StrategyCompress::Raw::Zlib::deflateStream::get_BufsizeCompress::Raw::Zlib::deflateStream::statusCompress::Raw::Zlib::deflateStream::crc32Compress::Raw::Zlib::deflateStream::dict_adlerCompress::Raw::Zlib::deflateStream::adler32Compress::Raw::Zlib::deflateStream::compressedBytesCompress::Raw::Zlib::deflateStream::uncompressedBytesCompress::Raw::Zlib::deflateStream::total_inCompress::Raw::Zlib::deflateStream::total_outCompress::Raw::Zlib::deflateStream::msgCompress::Raw::Zlib::deflateStream::deflateTuneCompress::Raw::Zlib::inflateStream::DispStreamCompress::Raw::Zlib::inflateStream::inflateResetCompress::Raw::Zlib::inflateStream::inflateCompress::Raw::Zlib::inflateStream::inflateCountCompress::Raw::Zlib::inflateStream::compressedBytesCompress::Raw::Zlib::inflateStream::uncompressedBytesCompress::Raw::Zlib::inflateStream::inflateSyncCompress::Raw::Zlib::inflateStream::DESTROYCompress::Raw::Zlib::inflateStream::statusCompress::Raw::Zlib::inflateStream::crc32Compress::Raw::Zlib::inflateStream::dict_adlerCompress::Raw::Zlib::inflateStream::total_inCompress::Raw::Zlib::inflateStream::adler32Compress::Raw::Zlib::inflateStream::total_outCompress::Raw::Zlib::inflateStream::msgCompress::Raw::Zlib::inflateStream::get_BufsizeCompress::Raw::Zlib::inflateStream::set_AppendCompress::Raw::Zlib::inflateScanStream::DESTROYCompress::Raw::Zlib::inflateScanStream::DispStreamCompress::Raw::Zlib::inflateScanStream::inflateResetCompress::Raw::Zlib::inflateScanStream::scanCompress::Raw::Zlib::inflateScanStream::getEndOffsetCompress::Raw::Zlib::inflateScanStream::inflateCountCompress::Raw::Zlib::inflateScanStream::compressedBytesCompress::Raw::Zlib::inflateScanStream::uncompressedBytesCompress::Raw::Zlib::inflateScanStream::getLastBlockOffsetCompress::Raw::Zlib::inflateScanStream::getLastBufferOffsetCompress::Raw::Zlib::inflateScanStream::resetLastBlockByteCompress::Raw::Zlib::inflateScanStream::_createDeflateStreamCompress::Raw::Zlib::inflateScanStream::statusCompress::Raw::Zlib::inflateScanStream::crc32Compress::Raw::Zlib::inflateScanStream::adler32Compress::Raw::Zlib needs zlib version 1.x Compress::Raw::Zlib::gzip_os_codeCompress::Raw::Zlib::inflateScanStreamCompress::Raw::Zlib::inflateStreamCompress::Raw::Zlib::deflateStreaminf_s, flags, level, method, windowBits, memLevel, strategy, bufsizeflags, level, method, windowBits, memLevel, strategy, bufsize, dictionaryWide character in Compress::Raw::Zlib::Deflate::new dicrionary parameter%s: buffer parameter is not a SCALAR reference%s: buffer parameter is a reference to a referenceWide character in Compress::Raw::Zlib::crc32Wide character in Compress::Raw::Zlib::adler32Wide character in Compress::Raw::Zlib::Inflate::inflateSync%s: buffer parameter is read-onlyCompress::Raw::Zlib::Inflate::inflate input parameter cannot be read-only when ConsumeInput is specifiedWide character in Compress::Raw::Zlib::Inflate::inflate input parameterWide character in Compress::Raw::Zlib::Inflate::inflate output parameters, good_length, max_lazy, nice_length, max_chains, flags, level, strategy, bufsizeWide character in Compress::Raw::Zlib::Deflate::flush input parameterWide character in Compress::Raw::Zlib::Deflate::deflate input parameterWide character in Compress::Raw::Zlib::Deflate::deflate output parameterflags, windowBits, bufsize, dictionaryYour vendor has not defined Zlib macro %s, usedUnexpected return type %d while processing Zlib macro %s, usedWide character in Compress::Raw::Zlib::InflateScan::scan input parameterl<,l$\$L;D4 need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version H* Hop  ( (%hox%ooL$ov*********++&+6+F+V+f+v+++++++++,,&,6,F,V,f,v,,,,,,,,,--&-6-F-V-f-v---------..&.6.F.V.f.v......shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss o,   ` pp%oL$L$,2ox%x%@A %%hJ  ( (( SH*H*N`*`*`Y.._HHe m w~0 FILE9650c342/auto/File/Glob/Glob.soE0ELFp4pA4 (88>NN>NNQtdRtd>NN44e(H -A 5*1./ E@0!<,?=")6>B# ':9% ; F+(74D8$CG&32> @ >?@ABCDEFG%@^qqXC^s*; CE칍|QE + h!"sc;Q]k]61/(rv"L "|=]Qhp4 6 8*" P?`p / A+ PD P__gmon_start___init_fini__cxa_finalize_Jv_RegisterClassesbsd_globfreePerl_safesysfree__lxstat64__xstat64__ctype_tolower_locPerl_safesysreallocPerl_safesysmallocsysconf__errno_locationPL_memory_wrapPerl_croakreaddir64closedirPerl_my_strlcpyopendirstrcmpqsortgetpwnamgetenvgetuidgetpwuidbsd_globboot_File__GlobPL_stack_spPL_stack_basePL_markstack_ptrPerl_newSVpvnPerl_sv_derived_fromPerl_upg_versionPerl_vcmpXS_File__Glob_doglobPerl_newXS_flagsXS_File__Glob_constantPerl_newXSPL_unitcheckavPL_scopestack_ixPerl_call_listPL_sv_yesPerl_formPerl_get_svPerl_sv_2pv_flagsPerl_vstringifyPerl_sv_2mortalPerl_newSVpvfPerl_new_versionPerl_sv_freePerl_sv_free2PL_opPL_curpadPerl_sv_newmortalPL_stack_maxPL_sv_undefPerl_sv_setivPerl_mg_setPerl_stack_growPerl_croak_xs_usagestrlenPerl_newSVpvn_flagsPL_taintingPL_taintedPerl_sv_magicPerl_sv_2iv_flagslibc.so.6__stack_chk_fail_edata__bss_start_endGLIBC_2.1.3GLIBC_2.3GLIBC_2.4GLIBC_2.2GLIBC_2.0si ii ii ii ii POOO O O O>OCOOOOOOOO*O,O-O6O:PPP PPPP P P $P(P,P0P4P8P:u䉕eU1ҍ &9tdu틅@ @u1|$$D$Ue3u*<[^_]Ë|$$P(׍ʉ't&'UWVS\t9;UPzf?t~f[f*} BiE=wUȉM:}MċUȋE=wUUȋ<;}ffztV9u]f8@&;uuvvE D$U$f?u1\[^_]Í&JffMt1f!E}UЉʋM }E}1M耉E^ҍ=wU$UȋE}EwUMԋUȋ M;UEf]f>-tEuf;U΍vMʍ=wMMċ E}EwMzUԋMċU;MC}MV=wUȉM;UȋMċ9v5f;UwMf;NwᐋU;}؉Tt&f9ɉ:vbt&\[^_]ÍvUԋ KUWVSLEԋB\6UЋV*MEMm؃݃D$$E؉FE؋}؅TU؉V}ԍfuM+}9<$1učt&9t|u F uuċ}؋NMFF @u1L[^_]Ð}u7$UU9rlj$L[^_]ÍvU1ɉMUm؃݃wv$/E؋FSVE؍<1v9u)׉}u.$#FD$$UWVUUEff/U1Mt&fBf/t.ft)fH9U sָĐ^_]Í&f/MUuB9E ErɃf/f/MaMU9뿋}ufE$Ed1uUB t$}f/tE%=@=txUB}UE<$9E9E %UEQEU}L$D$T$UD$ E|$} T$U$E|$\E$zsE%=@`E;E Ef/f@>'UWVS| MEU} M$EU ;2eE19fn1f/=hG҈uዅ@ @"4$P B @v $;x.9spPfftf9vQffu9s?D$$+uwfgfG @$TMe3 p| [^_]Ívf9.$v|$D$T$L$ 4$D$X1G @V$WSReD$D$4$@ @4$Gu1}9t7҉uው4$D$Wt~;G u1vct&'USEU ò.$T$[]fUWVSLEÃ.EԋE E؋EM΋MԄMu(&EEt|JҀz UF׍xMǍH M܉